[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpmC
DDBJ      :rpmC         LSU ribosomal protein L29P
Swiss-Prot:RL29_LACS1   RecName: Full=50S ribosomal protein L29;

Homologs  Archaea  0/68 : Bacteria  93/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.2
:64 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->62 1r73A PDBj 3e-08 58.1 %
:RPS:PDB   1->62 3bboZ PDBj 4e-06 21.0 %
:RPS:SCOP  1->62 1vs6X1  a.2.2.1 * 1e-08 33.9 %
:HMM:SCOP  1->66 1r73A_ a.2.2.1 * 7.5e-19 57.6 %
:HMM:PFM   3->59 PF00831 * Ribosomal_L29 5.4e-26 63.2 57/58  
:BLT:SWISS 1->64 RL29_LACS1 4e-20 100.0 %
:PROS 39->53|PS00579|RIBOSOMAL_L29
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00231.1 GT:GENE rpmC GT:PRODUCT LSU ribosomal protein L29P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1491780..1491974) GB:FROM 1491780 GB:TO 1491974 GB:DIRECTION - GB:GENE rpmC GB:PRODUCT LSU ribosomal protein L29P GB:NOTE COG0255 [J] Ribosomal protein L29 GB:PROTEIN_ID ABE00231.1 GB:DB_XREF GI:90821592 GB:GENE:GENE rpmC LENGTH 64 SQ:AASEQ MKAKEINELTTAEMLEKEKQFKEELFNLRFQLATGQLENTARLKEVRKNIARIKTALRQQELNK GT:EXON 1|1-64:0| SW:ID RL29_LACS1 SW:DE RecName: Full=50S ribosomal protein L29; SW:GN Name=rpmC; OrderedLocusNames=LSL_1427; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->64|RL29_LACS1|4e-20|100.0|64/64| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 39->53|PS00579|RIBOSOMAL_L29|PDOC00501| SEG 13->28|emlekekqfkeelfnl| BL:PDB:NREP 1 BL:PDB:REP 1->62|1r73A|3e-08|58.1|62/66| RP:PDB:NREP 1 RP:PDB:REP 1->62|3bboZ|4e-06|21.0|62/65| HM:PFM:NREP 1 HM:PFM:REP 3->59|PF00831|5.4e-26|63.2|57/58|Ribosomal_L29| RP:SCP:NREP 1 RP:SCP:REP 1->62|1vs6X1|1e-08|33.9|62/63|a.2.2.1| HM:SCP:REP 1->66|1r73A_|7.5e-19|57.6|66/0|a.2.2.1|1/1|Ribosomal protein L29 (L29p)| OP:NHOMO 93 OP:NHOMOORG 93 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-11111111111111111111111111111111-111111111111111111111111111111111111111111------------------------------------------------1-11------------1--------------1-----1--111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 96.9 SQ:SECSTR ccHHHHHHccHHHHHHHHHHHTTHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccc## DISOP:02AL 1-1,63-65| PSIPRED ccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcc //