[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpmD
DDBJ      :rpmD         LSU ribosomal protein L30P
Swiss-Prot:RL30_LACS1   RecName: Full=50S ribosomal protein L30;

Homologs  Archaea  0/68 : Bacteria  175/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.59.1
:60 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->57 2zjrW PDBj 5e-10 44.4 %
:RPS:PDB   1->57 1bxyA PDBj 8e-15 45.6 %
:RPS:SCOP  1->57 1bxyA  d.59.1.1 * 4e-15 45.6 %
:HMM:SCOP  1->60 1bxyA_ d.59.1.1 * 8.8e-18 53.3 %
:RPS:PFM   4->54 PF00327 * Ribosomal_L30 2e-09 54.9 %
:HMM:PFM   3->54 PF00327 * Ribosomal_L30 8.4e-24 36.5 52/52  
:BLT:SWISS 1->60 RL30_LACS1 3e-29 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00221.1 GT:GENE rpmD GT:PRODUCT LSU ribosomal protein L30P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1487834..1488016) GB:FROM 1487834 GB:TO 1488016 GB:DIRECTION - GB:GENE rpmD GB:PRODUCT LSU ribosomal protein L30P GB:NOTE COG1841 [J] Ribosomal protein L30/L7E GB:PROTEIN_ID ABE00221.1 GB:DB_XREF GI:90821582 GB:GENE:GENE rpmD LENGTH 60 SQ:AASEQ MDKLKVTLIRSVIGRPQNQRDIVKGLGLGRVNSSVVVPDNAAMRGAIRKINHLVDVELAK GT:EXON 1|1-60:0| SW:ID RL30_LACS1 SW:DE RecName: Full=50S ribosomal protein L30; SW:GN Name=rpmD; OrderedLocusNames=LSL_1417; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->60|RL30_LACS1|3e-29|100.0|60/60| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 4->57|2zjrW|5e-10|44.4|54/55| RP:PDB:NREP 1 RP:PDB:REP 1->57|1bxyA|8e-15|45.6|57/60| RP:PFM:NREP 1 RP:PFM:REP 4->54|PF00327|2e-09|54.9|51/52|Ribosomal_L30| HM:PFM:NREP 1 HM:PFM:REP 3->54|PF00327|8.4e-24|36.5|52/52|Ribosomal_L30| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00327|IPR000517| GO:PFM GO:0005622|"GO:intracellular"|PF00327|IPR000517| GO:PFM GO:0005840|"GO:ribosome"|PF00327|IPR000517| GO:PFM GO:0006412|"GO:translation"|PF00327|IPR000517| RP:SCP:NREP 1 RP:SCP:REP 1->57|1bxyA|4e-15|45.6|57/60|d.59.1.1| HM:SCP:REP 1->60|1bxyA_|8.8e-18|53.3|60/60|d.59.1.1|1/1|Ribosomal protein L30p/L7e| OP:NHOMO 175 OP:NHOMOORG 175 OP:PATTERN -------------------------------------------------------------------- -------------1---11-11----11111-------------11--------------11---------------------------------------------1-----------------111-1-1----111--------------------------------------------11-------11111111111111111111111111111--11111111-11111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111---------------------------------1111----11--------------------------------------------------------------------------------------------------------------------------------------11111----------------------------------------------1-----------------11-1---------------------1------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------111---1--------------------------------------------------------------------------------------1----------------------------------------------11-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEccccTTccHHHHHHHHHHTcccTTcEEEEEccHHHHHHHHHTTTTEEEEEEc DISOP:02AL 1-1,60-61| PSIPRED ccEEEEEEEcccccccHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHEEEEEcc //