[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpmE
DDBJ      :rpmE         LSU ribosomal protein L31P
Swiss-Prot:RL31B_LACS1  RecName: Full=50S ribosomal protein L31 type B;

Homologs  Archaea  0/68 : Bacteria  507/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:82 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->79 2hgu3 PDBj 5e-10 52.4 %
:RPS:PDB   2->79 3bbo1 PDBj 9e-19 26.6 %
:RPS:SCOP  1->79 1vs6Z1  d.325.1.2 * 6e-22 40.0 %
:HMM:SCOP  1->84 1vs6Z1 d.325.1.2 * 1.3e-22 42.9 %
:RPS:PFM   1->79 PF01197 * Ribosomal_L31 5e-18 65.7 %
:HMM:PFM   1->79 PF01197 * Ribosomal_L31 1.3e-32 56.7 67/69  
:BLT:SWISS 1->82 RL31B_LACS1 8e-47 100.0 %
:PROS 49->70|PS01143|RIBOSOMAL_L31

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99160.1 GT:GENE rpmE GT:PRODUCT LSU ribosomal protein L31P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 378175..378423 GB:FROM 378175 GB:TO 378423 GB:DIRECTION + GB:GENE rpmE GB:PRODUCT LSU ribosomal protein L31P GB:NOTE COG0254 [J] Ribosomal protein L31 GB:PROTEIN_ID ABD99160.1 GB:DB_XREF GI:90820521 GB:GENE:GENE rpmE LENGTH 82 SQ:AASEQ MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGFTN GT:EXON 1|1-82:0| SW:ID RL31B_LACS1 SW:DE RecName: Full=50S ribosomal protein L31 type B; SW:GN Name=rpmE2; OrderedLocusNames=LSL_0347; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->82|RL31B_LACS1|8e-47|100.0|82/82| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 49->70|PS01143|RIBOSOMAL_L31|PDOC00880| BL:PDB:NREP 1 BL:PDB:REP 38->79|2hgu3|5e-10|52.4|42/71| RP:PDB:NREP 1 RP:PDB:REP 2->79|3bbo1|9e-19|26.6|64/72| RP:PFM:NREP 1 RP:PFM:REP 1->79|PF01197|5e-18|65.7|67/69|Ribosomal_L31| HM:PFM:NREP 1 HM:PFM:REP 1->79|PF01197|1.3e-32|56.7|67/69|Ribosomal_L31| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01197|IPR002150| GO:PFM GO:0005622|"GO:intracellular"|PF01197|IPR002150| GO:PFM GO:0005840|"GO:ribosome"|PF01197|IPR002150| GO:PFM GO:0006412|"GO:translation"|PF01197|IPR002150| RP:SCP:NREP 1 RP:SCP:REP 1->79|1vs6Z1|6e-22|40.0|65/70|d.325.1.2| HM:SCP:REP 1->84|1vs6Z1|1.3e-22|42.9|70/0|d.325.1.2|1/1|L28p-like| OP:NHOMO 541 OP:NHOMOORG 510 OP:PATTERN -------------------------------------------------------------------- --1111111111111-1----1--12-----121111111------11-1111111111111-211122211222211----1-----1111111111111111111111111111111111111--11--1111-------11----------------------------------------------111211111111111111-1122221-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-111-11--11111-111-1111-1111-----------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111111111-11111-22222221-----1--1-11------1-11111111-------11---------------------------111----1-1----------------------1-111------11-1-111231111111-211111211121111-11-11111111111111111111111111--------1111111-1111---1------------1-111-1-1----1--11111111111--111111-1-----11-1-1111-11111--1111111112211111111111111----------11111111--1------------------------------------11 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 96.3 SQ:SECSTR ccTTTcccccHHHHHcccccTTTccccccccccccccGGGTcccccccccccccccccccccccccccccccccccccc### DISOP:02AL 1-1,80-83| PSIPRED cccccccccEEEEEEEcccccEEEEEEEEccccEEEEEccccccEEEEEEccccccEEEcEEEEEEcccHHHHHHHHHcccc //