[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpmF
DDBJ      :rpmF         LSU ribosomal protein L32
Swiss-Prot:RL32_LACS1   RecName: Full=50S ribosomal protein L32;

Homologs  Archaea  0/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:58 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->55 2zjrZ PDBj 2e-08 40.5 %
:RPS:PDB   2->50 3d5b5 PDBj 8e-08 32.7 %
:RPS:SCOP  19->56 2hgj41  g.41.8.5 * 2e-10 39.5 %
:HMM:SCOP  2->57 2i2t01 g.41.8.5 * 1.9e-21 49.1 %
:RPS:PFM   19->57 PF01783 * Ribosomal_L32p 2e-08 53.8 %
:HMM:PFM   2->56 PF01783 * Ribosomal_L32p 1.3e-27 54.5 55/56  
:BLT:SWISS 1->58 RL32_LACS1 1e-23 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99316.1 GT:GENE rpmF GT:PRODUCT LSU ribosomal protein L32 GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 554993..555169 GB:FROM 554993 GB:TO 555169 GB:DIRECTION + GB:GENE rpmF GB:PRODUCT LSU ribosomal protein L32 GB:NOTE COG0333 [J] Ribosomal protein L32 GB:PROTEIN_ID ABD99316.1 GB:DB_XREF GI:90820677 GB:GENE:GENE rpmF LENGTH 58 SQ:AASEQ MAVPARRTSKTRKRLRRTHYKLQVPGMSACPNCGELRKAHHVCPSCGYYGDKEVVKTK GT:EXON 1|1-58:0| SW:ID RL32_LACS1 SW:DE RecName: Full=50S ribosomal protein L32; SW:GN Name=rpmF; OrderedLocusNames=LSL_0507; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->58|RL32_LACS1|1e-23|100.0|58/58| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| SEG 6->18|rrtsktrkrlrrt| BL:PDB:NREP 1 BL:PDB:REP 19->55|2zjrZ|2e-08|40.5|37/58| RP:PDB:NREP 1 RP:PDB:REP 2->50|3d5b5|8e-08|32.7|49/52| RP:PFM:NREP 1 RP:PFM:REP 19->57|PF01783|2e-08|53.8|39/56|Ribosomal_L32p| HM:PFM:NREP 1 HM:PFM:REP 2->56|PF01783|1.3e-27|54.5|55/56|Ribosomal_L32p| GO:PFM:NREP 3 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01783|IPR002677| GO:PFM GO:0006412|"GO:translation"|PF01783|IPR002677| GO:PFM GO:0015934|"GO:large ribosomal subunit"|PF01783|IPR002677| RP:SCP:NREP 1 RP:SCP:REP 19->56|2hgj41|2e-10|39.5|38/57|g.41.8.5| HM:SCP:REP 2->57|2i2t01|1.9e-21|49.1|55/0|g.41.8.5|1/1|Zn-binding ribosomal proteins| OP:NHOMO 71 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------1-----111--------------------------------------------------------------------------------------------------------1111111-11111111--111111-111111111111-111-1111111-11111-111111-1----1---1111---11-----------------------------------------------------------------------------------------1-----------------------------------------------------------------------------11-----1----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 55 STR:RPRED 94.8 SQ:SECSTR #ccccccccHHHHHHHTTTTcccccccEEccccccEEccccccTTTcccccccccc## DISOP:02AL 1-1,5-13,57-59| PSIPRED ccccHHHHHHHHHHHHHHHHHHccccEEEcccccccEEEEEccccccccccEEEEccc //