[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpmG.1
DDBJ      :rpmG         LSU ribosomal protein L33P
Swiss-Prot:RL331_LACS1  RecName: Full=50S ribosomal protein L33 1;

Homologs  Archaea  0/68 : Bacteria  261/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:49 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->49 3huz6 PDBj 6e-14 56.2 %
:RPS:PDB   1->49 3bbo3 PDBj 2e-11 49.0 %
:RPS:SCOP  1->49 1vs611  g.41.8.6 * 2e-12 34.7 %
:HMM:SCOP  1->49 2gya11 g.41.8.6 * 5.8e-16 61.2 %
:RPS:PFM   2->49 PF00471 * Ribosomal_L33 8e-08 64.6 %
:HMM:PFM   2->49 PF00471 * Ribosomal_L33 5.2e-24 62.5 48/48  
:BLT:SWISS 1->49 RL331_LACS1 8e-27 100.0 %
:PROS 17->36|PS00582|RIBOSOMAL_L33

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99357.1 GT:GENE rpmG.1 GT:PRODUCT LSU ribosomal protein L33P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 591222..591371 GB:FROM 591222 GB:TO 591371 GB:DIRECTION + GB:GENE rpmG GB:PRODUCT LSU ribosomal protein L33P GB:NOTE COG0267 [J] Ribosomal protein L33 GB:PROTEIN_ID ABD99357.1 GB:DB_XREF GI:90820718 GB:GENE:GENE rpmG LENGTH 49 SQ:AASEQ MRVNITLECTECHEQTYLTSKNKRNNPDRIELKKYCPRDHKVTLHRETK GT:EXON 1|1-49:0| SW:ID RL331_LACS1 SW:DE RecName: Full=50S ribosomal protein L33 1; SW:GN Name=rpmG1; OrderedLocusNames=LSL_0548; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->49|RL331_LACS1|8e-27|100.0|49/49| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 17->36|PS00582|RIBOSOMAL_L33|PDOC00503| BL:PDB:NREP 1 BL:PDB:REP 2->49|3huz6|6e-14|56.2|48/48| RP:PDB:NREP 1 RP:PDB:REP 1->49|3bbo3|2e-11|49.0|49/65| RP:PFM:NREP 1 RP:PFM:REP 2->49|PF00471|8e-08|64.6|48/48|Ribosomal_L33| HM:PFM:NREP 1 HM:PFM:REP 2->49|PF00471|5.2e-24|62.5|48/48|Ribosomal_L33| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00471|IPR001705| GO:PFM GO:0005622|"GO:intracellular"|PF00471|IPR001705| GO:PFM GO:0005840|"GO:ribosome"|PF00471|IPR001705| GO:PFM GO:0006412|"GO:translation"|PF00471|IPR001705| RP:SCP:NREP 1 RP:SCP:REP 1->49|1vs611|2e-12|34.7|49/54|g.41.8.6| HM:SCP:REP 1->49|2gya11|5.8e-16|61.2|49/0|g.41.8.6|1/1|Zn-binding ribosomal proteins| OP:NHOMO 333 OP:NHOMOORG 261 OP:PATTERN -------------------------------------------------------------------- ---11---------11111-11111-1111111111111111111111------------1111111111111111111111111---------------1----------------------------------------111-1-1--111--11--1---1---------1------------1111-1222222222-22222211-2221--111111111111-122-22222222222222122223111--11111--11--11111-222211212211-221112212221112222222222-1122222221-1111111111-111-11-1111-111111111111---111-1111--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----111111--------------1--------1111111-111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-21-1---1------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 100.0 SQ:SECSTR cccccEEccccTTccccccEEccTTcccccccccccccccccccccccc DISOP:02AL 20-21,23-26,47-50| PSIPRED cccEEEEEEccccccEEEEEccccccccEEEEEEcccccccEEEEEEcc //