[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpmG.2
DDBJ      :rpmG         LSU ribosomal protein L33P
Swiss-Prot:RL332_LACS1  RecName: Full=50S ribosomal protein L33 2;

Homologs  Archaea  0/68 : Bacteria  137/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:50 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->50 3huz6 PDBj 9e-10 48.9 %
:RPS:PDB   2->50 3bbo3 PDBj 3e-08 40.8 %
:RPS:SCOP  2->50 1vs611  g.41.8.6 * 3e-10 30.6 %
:HMM:SCOP  3->50 2gya11 g.41.8.6 * 3.3e-13 47.9 %
:RPS:PFM   6->50 PF00471 * Ribosomal_L33 7e-07 62.2 %
:HMM:PFM   4->50 PF00471 * Ribosomal_L33 4.5e-23 57.4 47/48  
:BLT:SWISS 1->50 RL332_LACS1 3e-27 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00050.1 GT:GENE rpmG.2 GT:PRODUCT LSU ribosomal protein L33P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1274264..1274416) GB:FROM 1274264 GB:TO 1274416 GB:DIRECTION - GB:GENE rpmG GB:PRODUCT LSU ribosomal protein L33P GB:NOTE COG0267 [J] Ribosomal protein L33 GB:PROTEIN_ID ABE00050.1 GB:DB_XREF GI:90821411 GB:GENE:GENE rpmG LENGTH 50 SQ:AASEQ MANKKKVALACSECGSRNYTITENPNRTERLEVQKFCKYCGKHTLHRETK GT:EXON 1|1-50:0| SW:ID RL332_LACS1 SW:DE RecName: Full=50S ribosomal protein L33 2; SW:GN Name=rpmG2; OrderedLocusNames=LSL_1243; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->50|RL332_LACS1|3e-27|100.0|50/50| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 6->50|3huz6|9e-10|48.9|45/48| RP:PDB:NREP 1 RP:PDB:REP 2->50|3bbo3|3e-08|40.8|49/65| RP:PFM:NREP 1 RP:PFM:REP 6->50|PF00471|7e-07|62.2|45/48|Ribosomal_L33| HM:PFM:NREP 1 HM:PFM:REP 4->50|PF00471|4.5e-23|57.4|47/48|Ribosomal_L33| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00471|IPR001705| GO:PFM GO:0005622|"GO:intracellular"|PF00471|IPR001705| GO:PFM GO:0005840|"GO:ribosome"|PF00471|IPR001705| GO:PFM GO:0006412|"GO:translation"|PF00471|IPR001705| RP:SCP:NREP 1 RP:SCP:REP 2->50|1vs611|3e-10|30.6|49/54|g.41.8.6| HM:SCP:REP 3->50|2gya11|3.3e-13|47.9|48/0|g.41.8.6|1/1|Zn-binding ribosomal proteins| OP:NHOMO 155 OP:NHOMOORG 137 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------1-111111111-1-----------------------------------------------------------------------------------------------------------111111---1---------11111--1111-11111-1-1---22222222222222122221-111-1111111-111111-1-1111--1-11---11----1-111---1111111111---11111111--11--------111-11-1111-111-11-111-----1-1-111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-11---------------------11-1-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 98.0 SQ:SECSTR #ccccccEEccccTTccccccccccTcccccccccccccccccccccccc DISOP:02AL 1-3,20-30,47-51| PSIPRED cccccEEEEEEEccccccEEEccccccccEEEHHHHccccccccccEEcc //