[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpmH
DDBJ      :rpmH         LSU ribosomal protein L34P
Swiss-Prot:RL34_LACS1   RecName: Full=50S ribosomal protein L34;

Homologs  Archaea  0/68 : Bacteria  329/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:44 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->43 1yl37 PDBj 1e-12 65.1 %
:HMM:PFM   1->44 PF00468 * Ribosomal_L34 5.9e-26 70.5 44/44  
:BLT:SWISS 1->44 RL34_LACS1 1e-21 100.0 %
:PROS 2->21|PS00784|RIBOSOMAL_L34

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00540.1 GT:GENE rpmH GT:PRODUCT LSU ribosomal protein L34P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1826490..1826624) GB:FROM 1826490 GB:TO 1826624 GB:DIRECTION - GB:GENE rpmH GB:PRODUCT LSU ribosomal protein L34P GB:NOTE COG0230 [J] Ribosomal protein L34 GB:PROTEIN_ID ABE00540.1 GB:DB_XREF GI:90821901 GB:GENE:GENE rpmH LENGTH 44 SQ:AASEQ MKRTYQPKKRHRQRVHGFRKRMSTSNGRNVLARRRRKGRKVLSA GT:EXON 1|1-44:0| SW:ID RL34_LACS1 SW:DE RecName: Full=50S ribosomal protein L34; SW:GN Name=rpmH; OrderedLocusNames=LSL_1738; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->44|RL34_LACS1|1e-21|100.0|44/44| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 2->21|PS00784|RIBOSOMAL_L34|PDOC00626| BL:PDB:NREP 1 BL:PDB:REP 1->43|1yl37|1e-12|65.1|43/46| HM:PFM:NREP 1 HM:PFM:REP 1->44|PF00468|5.9e-26|70.5|44/44|Ribosomal_L34| OP:NHOMO 331 OP:NHOMOORG 329 OP:PATTERN -------------------------------------------------------------------- 11---1-----1-1-1112-1-1111111111-1111111--11-------------------1------------11----------11111------1-11-11---1----------------1111-11111-----111---------------------------------------111-1------11111111111111111------1---111-11-11111--------------------1111111111---1111111111---111-111------------------------------------1--1-1-----------111----1---1-11-1-----1---1111-------1---11111-------------1-111111111-1-111-111-1-----11--111111-1---------11111111111-111111---------1----11------------------------111111-111111111-1111111--------------------------------------------1------------1-1---1-111-1-1--1----111111-111-111-1--1111----111-111-------1----1-11-----111----------1---1---------------------------------1--1-----------------1-------1-------------1-1-1111111111----1111111111111111111111111111-1-11-1111--1111----------111-11111-----11------------------1111----------111111--11--1------1-1-111------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 43 STR:RPRED 97.7 SQ:SECSTR ccccccccHHHHHHHccHHHHHHcHHHHHHHHHHHHHHccccT# DISOP:02AL 1-17,40-45| PSIPRED ccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHccc //