[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpmI
DDBJ      :rpmI         LSU ribosomal protein L35P
Swiss-Prot:RL35_LACS1   RecName: Full=50S ribosomal protein L35;

Homologs  Archaea  0/68 : Bacteria  253/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.301.1
:66 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->58 3bbo5 PDBj 2e-07 41.1 %
:RPS:PDB   3->62 3bbo5 PDBj 2e-08 40.0 %
:RPS:SCOP  2->62 1vs631  d.301.1.1 * 1e-11 44.3 %
:HMM:SCOP  2->65 2i2t31 d.301.1.1 * 2.3e-20 45.3 %
:HMM:PFM   2->62 PF01632 * Ribosomal_L35p 9.6e-23 50.8 61/61  
:BLT:SWISS 1->66 RL35_LACS1 4e-34 100.0 %
:PROS 5->31|PS00936|RIBOSOMAL_L35

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99305.1 GT:GENE rpmI GT:PRODUCT LSU ribosomal protein L35P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 546477..546677 GB:FROM 546477 GB:TO 546677 GB:DIRECTION + GB:GENE rpmI GB:PRODUCT LSU ribosomal protein L35P GB:NOTE COG0291 [J] Ribosomal protein L35 GB:PROTEIN_ID ABD99305.1 GB:DB_XREF GI:90820666 GB:GENE:GENE rpmI LENGTH 66 SQ:AASEQ MPKQKTHRASAKRFKRTGNGGLKRSNAYTSHRFHGKTKKQRRQLRKASMVSASDMKRIKQMLSQMK GT:EXON 1|1-66:0| SW:ID RL35_LACS1 SW:DE RecName: Full=50S ribosomal protein L35; SW:GN Name=rpmI; OrderedLocusNames=LSL_0496; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->66|RL35_LACS1|4e-34|100.0|66/66| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 5->31|PS00936|RIBOSOMAL_L35|PDOC00721| BL:PDB:NREP 1 BL:PDB:REP 3->58|3bbo5|2e-07|41.1|56/62| RP:PDB:NREP 1 RP:PDB:REP 3->62|3bbo5|2e-08|40.0|60/62| HM:PFM:NREP 1 HM:PFM:REP 2->62|PF01632|9.6e-23|50.8|61/61|Ribosomal_L35p| RP:SCP:NREP 1 RP:SCP:REP 2->62|1vs631|1e-11|44.3|61/64|d.301.1.1| HM:SCP:REP 2->65|2i2t31|2.3e-20|45.3|64/0|d.301.1.1|1/1|L35p-like| OP:NHOMO 253 OP:NHOMOORG 253 OP:PATTERN -------------------------------------------------------------------- 11--111----1-1----------1------11111------------------------------------------1-1------------1-------11--11--1---------------111--1---11-------------------------------------------------------11111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111--1111111-111-111-11-111---1---1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11-111111111-11--1--11---------111111111-------1----------------------1-----------1--1----------------------1--1-------------------------------------------------------------------1-------1---------------1----------1-------------------------------1111---------1------------1------------------------------1-----------------1----1-1-1--11111-1-1-1111--------11--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 93.9 SQ:SECSTR cccccccHHHHTTcccccccccEEEccccTTcccccccccTTcccEEEcccTHHHHTTTTTT#### DISOP:02AL 1-7,33-48,66-67| PSIPRED ccccHHcHHHHEEEEEcccccEEEEccccccccccccHHHHHHccccEEEcHHHHHHHHHHHHHcc //