[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpmJ
DDBJ      :rpmJ         LSU ribosomal protein L36P
Swiss-Prot:RL36_LACS1   RecName: Full=50S ribosomal protein L36;

Homologs  Archaea  0/68 : Bacteria  423/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
g.42.1
:37 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->37 2zjr4 PDBj 2e-13 75.7 %
:RPS:PDB   1->37 3bbo6 PDBj 4e-08 81.1 %
:HMM:SCOP  1->37 2i2t41 g.42.1.1 * 5.8e-15 67.6 %
:RPS:PFM   1->37 PF00444 * Ribosomal_L36 6e-04 73.0 %
:HMM:PFM   1->37 PF00444 * Ribosomal_L36 3.8e-24 70.3 37/38  
:BLT:SWISS 1->37 RL36_LACS1 4e-19 100.0 %
:PROS 11->36|PS00828|RIBOSOMAL_L36

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00216.1 GT:GENE rpmJ GT:PRODUCT LSU ribosomal protein L36P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1484722..1484835) GB:FROM 1484722 GB:TO 1484835 GB:DIRECTION - GB:GENE rpmJ GB:PRODUCT LSU ribosomal protein L36P GB:NOTE COG0257 [J] Ribosomal protein L36 GB:PROTEIN_ID ABE00216.1 GB:DB_XREF GI:90821577 GB:GENE:GENE rpmJ LENGTH 37 SQ:AASEQ MKVRPSVKPMCEHCKVIKRKGRVMVICSNPKHKQRQG GT:EXON 1|1-37:0| SW:ID RL36_LACS1 SW:DE RecName: Full=50S ribosomal protein L36; SW:GN Name=rpmJ; OrderedLocusNames=LSL_1412; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->37|RL36_LACS1|4e-19|100.0|37/37| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 11->36|PS00828|RIBOSOMAL_L36|PDOC00650| BL:PDB:NREP 1 BL:PDB:REP 1->37|2zjr4|2e-13|75.7|37/37| RP:PDB:NREP 1 RP:PDB:REP 1->37|3bbo6|4e-08|81.1|37/38| RP:PFM:NREP 1 RP:PFM:REP 1->37|PF00444|6e-04|73.0|37/38|Ribosomal_L36| HM:PFM:NREP 1 HM:PFM:REP 1->37|PF00444|3.8e-24|70.3|37/38|Ribosomal_L36| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00444|IPR000473| GO:PFM GO:0005622|"GO:intracellular"|PF00444|IPR000473| GO:PFM GO:0005840|"GO:ribosome"|PF00444|IPR000473| GO:PFM GO:0006412|"GO:translation"|PF00444|IPR000473| HM:SCP:REP 1->37|2i2t41|5.8e-15|67.6|37/0|g.42.1.1|1/1|Ribosomal protein L36| OP:NHOMO 457 OP:NHOMOORG 450 OP:PATTERN -------------------------------------------------------------------- 11111---------11111-1---1111111111111111111-1111111111111111111111111111-111111111----11-------------------------------------11-11-1---111111111---1-1---1111111111---1111-111----11-1-1111111-1111111111-1111111111111--111--11111-111111111111-111111111111111111111-1111111111-111111-1111111-11---11-11111111111111111--1111111-11111111111111111111111-11-1-111--111111-1111---11------------------------------------------------------------------------------------------------------------------------------11111---------------------------------1-----11----1------1------------1-----1--111111--------1---------1----------------------1111-1111-1-1-2-11-111-111111-11--1----11-------111-1-111-111-11-111111----1--11111----11--1--11--1----11111-1-111111-11-11-----11--11----------11111111-11-11-1111----------------------------------------11111111111-----------------11-1-12-11111111111-----1--11-------1--1--111-11-1111-1--- -----------------------11-1--11-111--11111-------------------------------------------------1--1-111--1-----------------------------------------------------------------------------4-11111--2-2-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 100.0 SQ:SECSTR cccccccccccTTcccEEETTEEEcccccGGGccccc DISOP:02AL 1-4,32-38| PSIPRED cccccHHHHHHcccEEEEEccEEEEEEccccHHHccc //