[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpoD
DDBJ      :rpoD         RNA polymerase sigma factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  909/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13
:372 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   126->371 3dxjF PDBj 9e-82 65.0 %
:RPS:PDB   98->371 3dxjF PDBj 9e-55 61.5 %
:RPS:SCOP  37->206 1sigA  a.177.1.1 * 1e-34 41.8 %
:RPS:SCOP  210->268 1iw7F1  a.4.13.1 * 1e-18 67.8 %
:RPS:SCOP  303->361 1ku3A  a.4.13.2 * 2e-16 64.4 %
:HMM:SCOP  100->209 1ku2A2 a.177.1.1 * 6.1e-56 70.9 %
:HMM:SCOP  212->286 1rp3A1 a.4.13.1 * 2.4e-22 44.0 %
:HMM:SCOP  269->373 1iw7F2 a.4.13.2 * 3.8e-29 48.6 %
:RPS:PFM   101->133 PF00140 * Sigma70_r1_2 9e-08 78.8 %
:RPS:PFM   139->211 PF04542 * Sigma70_r2 7e-09 43.5 %
:RPS:PFM   218->291 PF04539 * Sigma70_r3 5e-17 58.1 %
:RPS:PFM   308->359 PF04545 * Sigma70_r4 3e-08 66.7 %
:HMM:PFM   218->295 PF04539 * Sigma70_r3 1.1e-32 53.8 78/78  
:HMM:PFM   139->209 PF04542 * Sigma70_r2 7.7e-27 40.8 71/71  
:HMM:PFM   307->360 PF04545 * Sigma70_r4 2.6e-23 58.0 50/50  
:HMM:PFM   100->136 PF00140 * Sigma70_r1_2 4e-20 67.6 37/37  
:HMM:PFM   14->87 PF03979 * Sigma70_r1_1 1e-11 26.9 67/82  
:BLT:SWISS 7->372 RPOD_ENTFA e-157 81.4 %
:PROS 163->176|PS00715|SIGMA70_1
:PROS 332->358|PS00716|SIGMA70_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99719.1 GT:GENE rpoD GT:PRODUCT RNA polymerase sigma factor GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(932755..933873) GB:FROM 932755 GB:TO 933873 GB:DIRECTION - GB:GENE rpoD GB:PRODUCT RNA polymerase sigma factor GB:NOTE COG0568 [K] DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) GB:PROTEIN_ID ABD99719.1 GB:DB_XREF GI:90821080 GB:GENE:GENE rpoD LENGTH 372 SQ:AASEQ MAKEILENNPAFTKTLRDLIREYKPQKQVNYKVLTDKLVTPFKLDADQMDQLIGSIEDRGISVVDENGEPSAHSLKAAAKEAEKAENDKDVSAPSGVKINDPVRMYLKEIGRVNLLTADEEVALALKIEEGDQEAKQRLAEANLRLVVSIAKRYVGRGMSFLDLIQEGNMGLMKAVEKFDYRKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRIQRQMLQDLGREPMPEEIGAEMDMPTEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQDATSPAEHAAYELLKEQLESVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRSKQLKDFLE GT:EXON 1|1-372:0| BL:SWS:NREP 1 BL:SWS:REP 7->372|RPOD_ENTFA|e-157|81.4|365/368| PROS 163->176|PS00715|SIGMA70_1|PDOC00592| PROS 332->358|PS00716|SIGMA70_2|PDOC00592| SEG 76->86|kaaakeaekae| BL:PDB:NREP 1 BL:PDB:REP 126->371|3dxjF|9e-82|65.0|246/349| RP:PDB:NREP 1 RP:PDB:REP 98->371|3dxjF|9e-55|61.5|273/349| RP:PFM:NREP 4 RP:PFM:REP 101->133|PF00140|9e-08|78.8|33/36|Sigma70_r1_2| RP:PFM:REP 139->211|PF04542|7e-09|43.5|69/70|Sigma70_r2| RP:PFM:REP 218->291|PF04539|5e-17|58.1|74/78|Sigma70_r3| RP:PFM:REP 308->359|PF04545|3e-08|66.7|48/49|Sigma70_r4| HM:PFM:NREP 5 HM:PFM:REP 218->295|PF04539|1.1e-32|53.8|78/78|Sigma70_r3| HM:PFM:REP 139->209|PF04542|7.7e-27|40.8|71/71|Sigma70_r2| HM:PFM:REP 307->360|PF04545|2.6e-23|58.0|50/50|Sigma70_r4| HM:PFM:REP 100->136|PF00140|4e-20|67.6|37/37|Sigma70_r1_2| HM:PFM:REP 14->87|PF03979|1e-11|26.9|67/82|Sigma70_r1_1| GO:PFM:NREP 20 GO:PFM GO:0003677|"GO:DNA binding"|PF00140|IPR009042| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00140|IPR009042| GO:PFM GO:0006352|"GO:transcription initiation"|PF00140|IPR009042| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00140|IPR009042| GO:PFM GO:0016987|"GO:sigma factor activity"|PF00140|IPR009042| GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF04539|IPR007624| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04539|IPR007624| GO:PFM GO:0006352|"GO:transcription initiation"|PF04539|IPR007624| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04539|IPR007624| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04539|IPR007624| GO:PFM GO:0003677|"GO:DNA binding"|PF04545|IPR007630| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04545|IPR007630| GO:PFM GO:0006352|"GO:transcription initiation"|PF04545|IPR007630| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04545|IPR007630| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04545|IPR007630| RP:SCP:NREP 3 RP:SCP:REP 37->206|1sigA|1e-34|41.8|170/305|a.177.1.1| RP:SCP:REP 210->268|1iw7F1|1e-18|67.8|59/61|a.4.13.1| RP:SCP:REP 303->361|1ku3A|2e-16|64.4|59/61|a.4.13.2| HM:SCP:REP 100->209|1ku2A2|6.1e-56|70.9|110/0|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 212->286|1rp3A1|2.4e-22|44.0|75/0|a.4.13.1|1/2|Sigma3 and sigma4 domains of RNA polymerase sigma factors| HM:SCP:REP 269->373|1iw7F2|3.8e-29|48.6|105/105|a.4.13.2|2/2|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 3032 OP:NHOMOORG 932 OP:PATTERN -------------------------------------------------------------------- 2144722222222233333-36222333333245556465433431112332232111114472765DEC61111111211392254411111111111111112211242222222222222211-1111111115555611155U8A7776568866687866579AB758555558555532-1132255766666667566667687777666667777332222226822222222222222222221111211211111111111111111111111111111111111111111111111111111111111111176666665667667667666444757326647644576676656675112337222433333224222232223233333333333-3333533333323223333333332223333344444332222222222222343222222222222222222222222222222222233323366668645565664555564666656552244434333322533544533334222222233334433324323333333244554444555655744111111111111111111111111155443454444435444444444444444444212544422222243444444446444444-44444343444443443343334444434444444444444444424324432454545454444223233333444422444222222222222222222222222244444444464444444442222222223555544444545442222222222222222442222222222222243111111-11111111111111111112132112111231 -------1----------------------------------------------------------------------------------------------------5-------------------------------------------------1----------------4212K122336689-64871---6 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 284 STR:RPRED 76.3 SQ:SECSTR ########################################################################################TTcccccEHcccccTTTHHHHHHHHHHTccHHHHHHHTHHHHHHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHTTTTccTTcHHHHHHHTTcccHHHHHHHHHHHHHHHHHTTTcccGGGccc DISOP:02AL 1-18,71-101| PSIPRED ccccHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //