[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpoE
DDBJ      :rpoE         DNA-directed RNA polymerase delta chain
Swiss-Prot:RPOE_LACS1   RecName: Full=Probable DNA-directed RNA polymerase subunit delta;AltName: Full=RNAP delta factor;

Homologs  Archaea  0/68 : Bacteria  131/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->91 PF05066 * RNA_pol_delta 1e-28 80.2 %
:HMM:PFM   1->92 PF05066 * RNA_pol_delta 4.8e-43 60.9 92/94  
:HMM:PFM   92->194 PF07093 * SGT1 0.00063 28.3 99/601  
:BLT:SWISS 1->196 RPOE_LACS1 7e-65 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99154.1 GT:GENE rpoE GT:PRODUCT DNA-directed RNA polymerase delta chain GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 372021..372611 GB:FROM 372021 GB:TO 372611 GB:DIRECTION + GB:GENE rpoE GB:PRODUCT DNA-directed RNA polymerase delta chain GB:NOTE COG3343 [K] DNA-directed RNA polymerase, delta subunit GB:PROTEIN_ID ABD99154.1 GB:DB_XREF GI:90820515 GB:GENE:GENE rpoE LENGTH 196 SQ:AASEQ MELEKFKDANKDELSMIEVAHEILHQRGETMAFADLTNEIQVYLGKSDEEIRDRLAQFYTDLNIDGSFISLGDNVWGLRSWYPYDSIDEALVHGEDEEDEERPRKKRKKVNAFLADVSDDDDVIDYDDDDPEDEDLDNDYDDEDDDDDEGSHELKQYTKDLDDIDDGDDPEDELADGIEGQLTEFSDADLDEENQD GT:EXON 1|1-196:0| SW:ID RPOE_LACS1 SW:DE RecName: Full=Probable DNA-directed RNA polymerase subunit delta;AltName: Full=RNAP delta factor; SW:GN Name=rpoE; OrderedLocusNames=LSL_0341; SW:KW Complete proteome; DNA-directed RNA polymerase;Nucleotidyltransferase; Transcription; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->196|RPOE_LACS1|7e-65|100.0|196/196| GO:SWS:NREP 4 GO:SWS GO:0003899|"GO:DNA-directed RNA polymerase activity"|DNA-directed RNA polymerase| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 95->109|edeedeerprkkrkk| SEG 116->149|dvsddddvidyddddpededldndyddeddddde| SEG 160->177|dlddiddgddpedeladg| RP:PFM:NREP 1 RP:PFM:REP 11->91|PF05066|1e-28|80.2|81/87|RNA_pol_delta| HM:PFM:NREP 2 HM:PFM:REP 1->92|PF05066|4.8e-43|60.9|92/94|RNA_pol_delta| HM:PFM:REP 92->194|PF07093|0.00063|28.3|99/601|SGT1| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF05066|IPR007759| GO:PFM GO:0006350|"GO:transcription"|PF05066|IPR007759| OP:NHOMO 131 OP:NHOMOORG 131 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-6,93-109,189-197| PSIPRED cccccccHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccEEEccccEEEHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccHHccc //