[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsG
DDBJ      :rpsG         SSU ribosomal protein S7P
Swiss-Prot:RS7_LACS1    RecName: Full=30S ribosomal protein S7;

Homologs  Archaea  30/68 : Bacteria  911/915 : Eukaryota  110/199 : Viruses  0/175   --->[See Alignment]
a.75.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->148 1husA PDBj 7e-53 78.9 %
:RPS:PDB   3->155 3bbnG PDBj 2e-54 45.1 %
:RPS:SCOP  3->156 1fjgG  a.75.1.1 * 3e-55 52.6 %
:HMM:SCOP  1->149 1iqvA_ a.75.1.1 * 1.1e-58 57.7 %
:RPS:PFM   3->149 PF00177 * Ribosomal_S7 9e-39 57.6 %
:HMM:PFM   1->149 PF00177 * Ribosomal_S7 6.9e-66 56.1 148/148  
:BLT:SWISS 1->156 RS7_LACS1 8e-88 100.0 %
:PROS 20->46|PS00052|RIBOSOMAL_S7

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99016.1 GT:GENE rpsG GT:PRODUCT SSU ribosomal protein S7P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 243812..244282 GB:FROM 243812 GB:TO 244282 GB:DIRECTION + GB:GENE rpsG GB:PRODUCT SSU ribosomal protein S7P GB:NOTE COG0049 [J] Ribosomal protein S7 GB:PROTEIN_ID ABD99016.1 GB:DB_XREF GI:90820377 GB:GENE:GENE rpsG LENGTH 156 SQ:AASEQ MPRKGAVAKREVLPDPIYNSKLVTRLINRLMLDGKRGTASKILYQAFDIIKEQTGNEPLDVFEEAMKNIMPVLEVKARRVGGSNYQVPIEVRPDRRTTLGLRWLVQYSRLRGEHTMSERLAKEIMDAANNTGAAVKKREDTHKMADANRAFAHYRW GT:EXON 1|1-156:0| SW:ID RS7_LACS1 SW:DE RecName: Full=30S ribosomal protein S7; SW:GN Name=rpsG; OrderedLocusNames=LSL_0201; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->156|RS7_LACS1|8e-88|100.0|156/156| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 20->46|PS00052|RIBOSOMAL_S7|PDOC00051| BL:PDB:NREP 1 BL:PDB:REP 10->148|1husA|7e-53|78.9|133/133| RP:PDB:NREP 1 RP:PDB:REP 3->155|3bbnG|2e-54|45.1|153/154| RP:PFM:NREP 1 RP:PFM:REP 3->149|PF00177|9e-39|57.6|144/145|Ribosomal_S7| HM:PFM:NREP 1 HM:PFM:REP 1->149|PF00177|6.9e-66|56.1|148/148|Ribosomal_S7| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00177|IPR000235| GO:PFM GO:0005622|"GO:intracellular"|PF00177|IPR000235| GO:PFM GO:0005840|"GO:ribosome"|PF00177|IPR000235| GO:PFM GO:0006412|"GO:translation"|PF00177|IPR000235| RP:SCP:NREP 1 RP:SCP:REP 3->156|1fjgG|3e-55|52.6|154/155|a.75.1.1| HM:SCP:REP 1->149|1iqvA_|1.1e-58|57.7|149/201|a.75.1.1|1/1|Ribosomal protein S7| OP:NHOMO 1092 OP:NHOMOORG 1051 OP:PATTERN --11-1-1-------111111111---1-111111---------111----1-1-------111--11 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 1111--1-1---111-----------------------------------------------11111111111111111111111111-121-1------1111-1-1--2211212111-11121121161-11311111-11111-111111--1111111111-111411112-------2--32E-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 99.4 SQ:SECSTR #ccccccccccccccTTTccccGGGHHHHcccTTcHHHHHHHHcHHHHTTTTTccccTTHHHHHHGGGTcccEEEccEEETTEEEccEEEccHHHHHHHHTTHHHHHHHTcccccHHHHHHHHHHHHHHTcHHHHHHHHHHHHHccccGGGccccc DISOP:02AL 1-6,8-8| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccEEEEEEEEEcccEEEccEEccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccc //