[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsH
DDBJ      :rpsH         SSU ribosomal protein S8P
Swiss-Prot:RS8_LACS1    RecName: Full=30S ribosomal protein S8;

Homologs  Archaea  62/68 : Bacteria  909/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
d.140.1
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->131 1seiA PDBj 3e-55 78.3 %
:RPS:PDB   3->132 3bbnH PDBj 4e-47 37.7 %
:RPS:SCOP  3->132 1i6uA  d.140.1.1 * 2e-42 27.6 %
:HMM:SCOP  2->132 1i6uA_ d.140.1.1 * 2.3e-49 50.0 %
:RPS:PFM   5->131 PF00410 * Ribosomal_S8 6e-32 57.1 %
:HMM:PFM   5->132 PF00410 * Ribosomal_S8 6.2e-52 55.5 128/129  
:BLT:SWISS 1->132 RS8_LACS1 2e-71 100.0 %
:PROS 102->119|PS00053|RIBOSOMAL_S8

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00225.1 GT:GENE rpsH GT:PRODUCT SSU ribosomal protein S8P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1489522..1489920) GB:FROM 1489522 GB:TO 1489920 GB:DIRECTION - GB:GENE rpsH GB:PRODUCT SSU ribosomal protein S8P GB:NOTE COG0096 [J] Ribosomal protein S8 GB:PROTEIN_ID ABE00225.1 GB:DB_XREF GI:90821586 GB:GENE:GENE rpsH LENGTH 132 SQ:AASEQ MVMTDPIADFLTRIRNANMAKHESLEVPASKIKRDIAEILKNEGFVRDVEYIDDDKQGIIRVFLKYGKGNERVISGIRRISKPGLRSYVKADAVPKVLNGLGIAILSTSEGVITDKEARAKKIGGEVIAYIW GT:EXON 1|1-132:0| SW:ID RS8_LACS1 SW:DE RecName: Full=30S ribosomal protein S8; SW:GN Name=rpsH; OrderedLocusNames=LSL_1421; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->132|RS8_LACS1|2e-71|100.0|132/132| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 102->119|PS00053|RIBOSOMAL_S8|PDOC00052| BL:PDB:NREP 1 BL:PDB:REP 2->131|1seiA|3e-55|78.3|129/130| RP:PDB:NREP 1 RP:PDB:REP 3->132|3bbnH|4e-47|37.7|130/134| RP:PFM:NREP 1 RP:PFM:REP 5->131|PF00410|6e-32|57.1|126/127|Ribosomal_S8| HM:PFM:NREP 1 HM:PFM:REP 5->132|PF00410|6.2e-52|55.5|128/129|Ribosomal_S8| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00410|IPR000630| GO:PFM GO:0005622|"GO:intracellular"|PF00410|IPR000630| GO:PFM GO:0005840|"GO:ribosome"|PF00410|IPR000630| GO:PFM GO:0006412|"GO:translation"|PF00410|IPR000630| RP:SCP:NREP 1 RP:SCP:REP 3->132|1i6uA|2e-42|27.6|127/129|d.140.1.1| HM:SCP:REP 2->132|1i6uA_|2.3e-49|50.0|128/129|d.140.1.1|1/1|Ribosomal protein S8| OP:NHOMO 1028 OP:NHOMOORG 1004 OP:PATTERN 111111111111111111111111--111-11111111111111111-111111111111111111-- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------------------------------------------11------------212-----21112121112--1------31-11--------------------------------------------------------------------------------2-21A111-2-112--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 99.2 SQ:SECSTR #ccccHHHHHHHHHHHHHHTTccEEEEEccHHHHHHTHHHHTTTccccEEEEEccccEEEEEEcccccccccccccEEEcccTTcccEEcccccccGGGTTcEEEEEEcccEEcTTHHHHHTccEEEEEEEc DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHccccccEEEEEccccEEEEEEEEEcccccccccccEEcccccEEEEEcHHHcHHHHcccEEEEEEcccccccHHHHHHcccccEEEEEEc //