[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsI
DDBJ      :rpsI         SSU ribosomal protein S9P
Swiss-Prot:RS9_LACS1    RecName: Full=30S ribosomal protein S9;

Homologs  Archaea  1/68 : Bacteria  905/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->130 1vs5I PDBj 3e-28 48.4 %
:RPS:PDB   6->130 3bbnI PDBj 3e-40 48.8 %
:RPS:SCOP  5->130 1fjgI  d.14.1.1 * 8e-42 47.6 %
:HMM:SCOP  4->130 1fjgI_ d.14.1.1 * 1.4e-47 57.5 %
:RPS:PFM   10->130 PF00380 * Ribosomal_S9 3e-29 60.3 %
:HMM:PFM   10->130 PF00380 * Ribosomal_S9 8.3e-50 57.9 121/121  
:BLT:SWISS 1->130 RS9_LACS1 1e-64 100.0 %
:PROS 69->87|PS00360|RIBOSOMAL_S9
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00206.1 GT:GENE rpsI GT:PRODUCT SSU ribosomal protein S9P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1477906..1478298) GB:FROM 1477906 GB:TO 1478298 GB:DIRECTION - GB:GENE rpsI GB:PRODUCT SSU ribosomal protein S9P GB:NOTE COG0103 [J] Ribosomal protein S9 GB:PROTEIN_ID ABE00206.1 GB:DB_XREF GI:90821567 GB:GENE:GENE rpsI LENGTH 130 SQ:AASEQ MAQVQYQGTGRRKNSVARVRLVPGTGKITMNGKPAEEYIPFANIREDMVQPFGVTETKGQYDVFVNVNGGGFSGQAGATRHGIARALLEVDPDFRGVLKSTGLLTRDARMKERKKPGLKKARKASQFSKR GT:EXON 1|1-130:0| SW:ID RS9_LACS1 SW:DE RecName: Full=30S ribosomal protein S9; SW:GN Name=rpsI; OrderedLocusNames=LSL_1402; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->130|RS9_LACS1|1e-64|100.0|130/130| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 69->87|PS00360|RIBOSOMAL_S9|PDOC00311| SEG 63->72|vfvnvngggf| BL:PDB:NREP 1 BL:PDB:REP 5->130|1vs5I|3e-28|48.4|126/127| RP:PDB:NREP 1 RP:PDB:REP 6->130|3bbnI|3e-40|48.8|125/127| RP:PFM:NREP 1 RP:PFM:REP 10->130|PF00380|3e-29|60.3|121/121|Ribosomal_S9| HM:PFM:NREP 1 HM:PFM:REP 10->130|PF00380|8.3e-50|57.9|121/121|Ribosomal_S9| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00380|IPR000754| GO:PFM GO:0005622|"GO:intracellular"|PF00380|IPR000754| GO:PFM GO:0005840|"GO:ribosome"|PF00380|IPR000754| GO:PFM GO:0006412|"GO:translation"|PF00380|IPR000754| RP:SCP:NREP 1 RP:SCP:REP 5->130|1fjgI|8e-42|47.6|126/127|d.14.1.1| HM:SCP:REP 4->130|1fjgI_|1.4e-47|57.5|127/127|d.14.1.1|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 1074 OP:NHOMOORG 1051 OP:PATTERN -------------------------------------------------------------1------ 1111111111111111111-11111111111111111111111111111111111111111111111111-11111111111111111111111111--1111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111121111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 1---111-1------111-111111111111-11111211111-1-1111111111111111111111-1111-11111111111111--111111-------111-12111--1111--1--111-1-131-112111-1--1-------111111-111-111-11-1---111--161111122431221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 96.9 SQ:SECSTR ####ccccccEETTEEEEEEEEEccccEEETTEEHHHHccccGGGTTTcHHHHTTTcTTTEEEEEEEEcccHHHHHHHHHHHHHHHTTTccGGGcHHHHTTTcccccccccccccTTcccTTcccccccc DISOP:02AL 1-1,113-119,129-129| PSIPRED cccEEEEEEEEEEEEEEEEEEEccccEEEEccEEHHHHcccHHHHHHHHHHHHHHcccccccEEEEEccccEEHHHHHHHHHHHHHHHHHcHHHHHHHHHcccEEccccccccccccccccccccccccc //