[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsK
DDBJ      :rpsK         SSU ribosomal protein S11P
Swiss-Prot:RS11_LACS1   RecName: Full=30S ribosomal protein S11;

Homologs  Archaea  39/68 : Bacteria  906/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
c.55.4
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->128 1vs5K PDBj 1e-42 63.2 %
:RPS:PDB   14->125 2e5lK PDBj 2e-43 60.7 %
:RPS:SCOP  14->127 1fjgK  c.55.4.1 * 2e-44 60.5 %
:HMM:SCOP  12->128 1fjgK_ c.55.4.1 * 3.6e-46 66.7 %
:RPS:PFM   19->127 PF00411 * Ribosomal_S11 6e-36 67.9 %
:HMM:PFM   18->127 PF00411 * Ribosomal_S11 3.8e-53 61.8 110/110  
:BLT:SWISS 14->128 RS11_LACS1 3e-63 100.0 %
:PROS 96->118|PS00054|RIBOSOMAL_S11
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00214.1 GT:GENE rpsK GT:PRODUCT SSU ribosomal protein S11P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1483917..1484303) GB:FROM 1483917 GB:TO 1484303 GB:DIRECTION - GB:GENE rpsK GB:PRODUCT SSU ribosomal protein S11P GB:NOTE COG0100 [J] Ribosomal protein S11 GB:PROTEIN_ID ABE00214.1 GB:DB_XREF GI:90821575 GB:GENE:GENE rpsK LENGTH 128 SQ:AASEQ MAVKKSRKRRVKKNIESGVAHIHSTFNNTLVMITDVHGNAVAWSSAGSLGFKGSRKSTPFAAQMASEAAAKGAMEHGMKTVEVAVKGPGSGREAAIRALQTTGLEVTSIKDVTPVPHNGCRPPKRRRV GT:EXON 1|1-128:0| SW:ID RS11_LACS1 SW:DE RecName: Full=30S ribosomal protein S11; SW:GN Name=rpsK; OrderedLocusNames=LSL_1410; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 14->128|RS11_LACS1|3e-63|100.0|115/128| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 96->118|PS00054|RIBOSOMAL_S11|PDOC00053| SEG 3->13|vkksrkrrvkk| BL:PDB:NREP 1 BL:PDB:REP 15->128|1vs5K|1e-42|63.2|114/117| RP:PDB:NREP 1 RP:PDB:REP 14->125|2e5lK|2e-43|60.7|112/115| RP:PFM:NREP 1 RP:PFM:REP 19->127|PF00411|6e-36|67.9|109/109|Ribosomal_S11| HM:PFM:NREP 1 HM:PFM:REP 18->127|PF00411|3.8e-53|61.8|110/110|Ribosomal_S11| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00411|IPR001971| GO:PFM GO:0005622|"GO:intracellular"|PF00411|IPR001971| GO:PFM GO:0005840|"GO:ribosome"|PF00411|IPR001971| GO:PFM GO:0006412|"GO:translation"|PF00411|IPR001971| RP:SCP:NREP 1 RP:SCP:REP 14->127|1fjgK|2e-44|60.5|114/119|c.55.4.1| HM:SCP:REP 12->128|1fjgK_|3.6e-46|66.7|117/0|c.55.4.1|1/1|Translational machinery components| OP:NHOMO 1236 OP:NHOMOORG 1109 OP:PATTERN --------11111111--------1-11111111-11-1111111111-1111-----1--11111-- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111--1--111111111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 1--11111511-222-11111111111111111111111111111111111111111111111-1--1-----11-------111----1211111------1131112123322322-1122155-5-696-326121122141-11112112132221113222-11112223313191111326781431111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 89.8 SQ:SECSTR #############ccccEEEEEEccccccEEEEEcTTccEEEEEccTTTTcccGGGGcHHHHHHHHHHHHHTTGGGTccEEEEEEEcccccHHHHHHHHHHHTcEEEEEEEccccccccccccccccc DISOP:02AL 1-13,124-129| PSIPRED cccHHHHHHHHHHcccccEEEEEEccccEEEEEEcccccEEEEEEccccEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHcccEEEEEEEccccccccccccccccc //