[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsL
DDBJ      :rpsL         SSU ribosomal protein S12P
Swiss-Prot:RS12_LACS1   RecName: Full=30S ribosomal protein S12;

Homologs  Archaea  4/68 : Bacteria  904/915 : Eukaryota  157/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->136 3bbnL PDBj 3e-43 69.9 %
:RPS:PDB   1->136 3bbnL PDBj 5e-46 69.9 %
:RPS:SCOP  2->137 1fjgL  b.40.4.5 * 3e-46 69.1 %
:HMM:SCOP  2->139 1fjgL_ b.40.4.5 * 2.8e-49 69.6 %
:RPS:PFM   41->136 PF00164 * Ribosomal_S12 5e-36 87.5 %
:HMM:PFM   2->136 PF00164 * Ribosomal_S12 8.5e-51 65.6 122/122  
:BLT:SWISS 1->137 RS12_LACS1 2e-67 100.0 %
:PROS 56->63|PS00055|RIBOSOMAL_S12
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99015.1 GT:GENE rpsL GT:PRODUCT SSU ribosomal protein S12P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 243364..243777 GB:FROM 243364 GB:TO 243777 GB:DIRECTION + GB:GENE rpsL GB:PRODUCT SSU ribosomal protein S12P GB:NOTE COG0048 [J] Ribosomal protein S12 GB:PROTEIN_ID ABD99015.1 GB:DB_XREF GI:90820376 GB:GENE:GENE rpsL LENGTH 137 SQ:AASEQ MPTINQLIRKGRKSKGSKSNSPALNFGYNSYKKVQTNNSAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVEGRMQSRSKYGAKKPKK GT:EXON 1|1-137:0| SW:ID RS12_LACS1 SW:DE RecName: Full=30S ribosomal protein S12; SW:GN Name=rpsL; OrderedLocusNames=LSL_0200; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->137|RS12_LACS1|2e-67|100.0|137/137| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 56->63|PS00055|RIBOSOMAL_S12|PDOC00054| SEG 9->21|rkgrkskgsksns| BL:PDB:NREP 1 BL:PDB:REP 1->136|3bbnL|3e-43|69.9|123/123| RP:PDB:NREP 1 RP:PDB:REP 1->136|3bbnL|5e-46|69.9|123/123| RP:PFM:NREP 1 RP:PFM:REP 41->136|PF00164|5e-36|87.5|96/122|Ribosomal_S12| HM:PFM:NREP 1 HM:PFM:REP 2->136|PF00164|8.5e-51|65.6|122/122|Ribosomal_S12| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00164|IPR006032| GO:PFM GO:0005622|"GO:intracellular"|PF00164|IPR006032| GO:PFM GO:0005840|"GO:ribosome"|PF00164|IPR006032| GO:PFM GO:0006412|"GO:translation"|PF00164|IPR006032| RP:SCP:NREP 1 RP:SCP:REP 2->137|1fjgL|3e-46|69.1|123/125|b.40.4.5| HM:SCP:REP 2->139|1fjgL_|2.8e-49|69.6|125/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1093 OP:NHOMOORG 1065 OP:PATTERN -----1-----------------------------------------------1---11--------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111112-11111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111211111111111111111111111111111111111111111111111111111111111111111111111--111111111111111-11-111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11------1---11111111111111111----11111-111111111111111111111-111111111111111111111111121-11111111111111111-1--21211--1111-1111121323-111111111111-11-1111111111211111111-111121211--------3-8112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 97.1 SQ:SECSTR cccTTHHHHTcccccccccccccTT####ccccccccTTcccEEEEEEEEEEEcccccccccEEEEEEEETTccEEEEEcccccccccTTcEEEEccccccccTTccEEccTTcTTccccTTcccccccTTcccccc DISOP:02AL 9-38,121-138| PSIPRED cccHHHHHHHHHHccccccccHHHHHHcccccccccccccccccEEEEEEEEEcccccccccccEEEEEEccccEEEEEccccccccccccEEEEcccccccccccEEEEEccHHHHcccccccccccccccccccc //