[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsM
DDBJ      :rpsM         SSU ribosomal protein S13P
Swiss-Prot:RS13_LACS1   RecName: Full=30S ribosomal protein S13;

Homologs  Archaea  7/68 : Bacteria  907/915 : Eukaryota  83/199 : Viruses  0/175   --->[See Alignment]
a.156.1
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->121 2uuaM PDBj 6e-38 60.0 %
:RPS:PDB   2->121 2e5lM PDBj 4e-28 60.0 %
:RPS:SCOP  2->121 1fjgM  a.156.1.1 * 1e-28 59.2 %
:HMM:SCOP  2->120 1fjgM_ a.156.1.1 * 6.1e-42 60.5 %
:RPS:PFM   3->108 PF00416 * Ribosomal_S13 1e-29 68.9 %
:HMM:PFM   3->108 PF00416 * Ribosomal_S13 4.5e-40 47.2 106/106  
:BLT:SWISS 1->121 RS13_LACS1 6e-65 100.0 %
:PROS 87->100|PS00646|RIBOSOMAL_S13_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00215.1 GT:GENE rpsM GT:PRODUCT SSU ribosomal protein S13P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1484331..1484696) GB:FROM 1484331 GB:TO 1484696 GB:DIRECTION - GB:GENE rpsM GB:PRODUCT SSU ribosomal protein S13P GB:NOTE COG0099 [J] Ribosomal protein S13 GB:PROTEIN_ID ABE00215.1 GB:DB_XREF GI:90821576 GB:GENE:GENE rpsM LENGTH 121 SQ:AASEQ MARIAGVDLPRNKRVVIGLTYIYGIGNSTAQKILSEAGVSEDVRVRDLTADQEDKIRAVVDKYKVEGDLRREVSLNIKRLSEIGSYRGLRHRRHLPVRGQNTKNNARTRKGPAVSIAGKKK GT:EXON 1|1-121:0| SW:ID RS13_LACS1 SW:DE RecName: Full=30S ribosomal protein S13; SW:GN Name=rpsM; OrderedLocusNames=LSL_1411; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->121|RS13_LACS1|6e-65|100.0|121/121| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 87->100|PS00646|RIBOSOMAL_S13_1|PDOC00556| BL:PDB:NREP 1 BL:PDB:REP 2->121|2uuaM|6e-38|60.0|120/125| RP:PDB:NREP 1 RP:PDB:REP 2->121|2e5lM|4e-28|60.0|120/122| RP:PFM:NREP 1 RP:PFM:REP 3->108|PF00416|1e-29|68.9|106/107|Ribosomal_S13| HM:PFM:NREP 1 HM:PFM:REP 3->108|PF00416|4.5e-40|47.2|106/106|Ribosomal_S13| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF00416|IPR001892| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00416|IPR001892| GO:PFM GO:0005622|"GO:intracellular"|PF00416|IPR001892| GO:PFM GO:0005840|"GO:ribosome"|PF00416|IPR001892| GO:PFM GO:0006412|"GO:translation"|PF00416|IPR001892| RP:SCP:NREP 1 RP:SCP:REP 2->121|1fjgM|1e-28|59.2|120/125|a.156.1.1| HM:SCP:REP 2->120|1fjgM_|6.1e-42|60.5|119/125|a.156.1.1|1/1|S13-like H2TH domain| OP:NHOMO 1023 OP:NHOMOORG 997 OP:PATTERN ----------------------------------111----------1-1--1-------1------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------111111-111--1----1---111-111111--1--1111111111111--111111211-11-111111111111-1--11-1---1--11-1--2-------------------------------------------------1----------------1111E1111131-3122------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 100.0 SQ:SECSTR GcccTTTcccccccHHHHGGGcTTccTTTTGGGTTTTcccTTccGGGccHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHTTcHHHHHHHHTccccccccccccHHHHccccccccccc DISOP:02AL 112-114,116-122| PSIPRED ccEEEccccccccEEEEEEEEHHcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHccccccccccccccccccccccccccccc //