[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsO
DDBJ      :rpsO         SSU ribosomal protein S15P
Swiss-Prot:RS15_LACS1   RecName: Full=30S ribosomal protein S15;

Homologs  Archaea  0/68 : Bacteria  894/915 : Eukaryota  50/199 : Viruses  0/175   --->[See Alignment]
a.16.1
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->87 1a32A PDBj 3e-28 61.2 %
:RPS:PDB   5->88 3bbnO PDBj 2e-25 38.1 %
:RPS:SCOP  3->87 1a32A  a.16.1.2 * 4e-24 61.2 %
:HMM:SCOP  2->89 1g1xB_ a.16.1.2 * 1.8e-30 52.3 %
:RPS:PFM   6->87 PF00312 * Ribosomal_S15 2e-16 57.3 %
:HMM:PFM   7->88 PF00312 * Ribosomal_S15 3.9e-30 46.3 82/83  
:BLT:SWISS 1->89 RS15_LACS1 2e-47 100.0 %
:PROS 39->69|PS00362|RIBOSOMAL_S15

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99448.1 GT:GENE rpsO GT:PRODUCT SSU ribosomal protein S15P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 681489..681758 GB:FROM 681489 GB:TO 681758 GB:DIRECTION + GB:GENE rpsO GB:PRODUCT SSU ribosomal protein S15P GB:NOTE COG0184 [J] Ribosomal protein S15P/S13E GB:PROTEIN_ID ABD99448.1 GB:DB_XREF GI:90820809 GB:GENE:GENE rpsO LENGTH 89 SQ:AASEQ MAISQEKKNEIMKKYARHEGDTGSAEVQIAVLTADINELNDHIKAHKKDYASYRGLMKKIGHRRNLLAYLRNTDVQRYRELVKSLGLRR GT:EXON 1|1-89:0| SW:ID RS15_LACS1 SW:DE RecName: Full=30S ribosomal protein S15; SW:GN Name=rpsO; OrderedLocusNames=LSL_0638; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->89|RS15_LACS1|2e-47|100.0|89/89| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 39->69|PS00362|RIBOSOMAL_S15|PDOC00313| BL:PDB:NREP 1 BL:PDB:REP 3->87|1a32A|3e-28|61.2|85/85| RP:PDB:NREP 1 RP:PDB:REP 5->88|3bbnO|2e-25|38.1|84/85| RP:PFM:NREP 1 RP:PFM:REP 6->87|PF00312|2e-16|57.3|82/83|Ribosomal_S15| HM:PFM:NREP 1 HM:PFM:REP 7->88|PF00312|3.9e-30|46.3|82/83|Ribosomal_S15| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00312|IPR000589| GO:PFM GO:0005622|"GO:intracellular"|PF00312|IPR000589| GO:PFM GO:0005840|"GO:ribosome"|PF00312|IPR000589| GO:PFM GO:0006412|"GO:translation"|PF00312|IPR000589| RP:SCP:NREP 1 RP:SCP:REP 3->87|1a32A|4e-24|61.2|85/85|a.16.1.2| HM:SCP:REP 2->89|1g1xB_|1.8e-30|52.3|88/88|a.16.1.2|1/1|S15/NS1 RNA-binding domain| OP:NHOMO 962 OP:NHOMOORG 944 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111-1111111111-111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111-111111111111111-1111111111111111111111111111-111111111111111111111111111111111111-11111111111111111111111112111111111111111111111111111111111111111111111111111111-111111111111111111111-11111111111111111111-1-11111111111111111111111111111111 -1--11-1------1------------------------------------------------1-1111-1-111-11111------1---------------112--21------1----------1------11-------1--------1---------------------112127111221--2-1122-1--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 98.9 SQ:SECSTR #ccccHHHHHHHHHHcccccccccTTHHHHHHHHHHTTTTTTTTTcTTccTTcHHHHHHHHHHHHHHTTHHHHccHHHHTTTTTTTccc DISOP:02AL 1-5| PSIPRED ccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccc //