[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsP
DDBJ      :rpsP         SSU ribosomal protein S16P
Swiss-Prot:RS16_LACS1   RecName: Full=30S ribosomal protein S16;

Homologs  Archaea  0/68 : Bacteria  888/915 : Eukaryota  125/199 : Viruses  0/175   --->[See Alignment]
d.27.1
:91 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->82 2j00P PDBj 8e-19 50.0 %
:RPS:PDB   3->83 3bbnP PDBj 4e-31 46.8 %
:RPS:SCOP  3->82 1fjgP  d.27.1.1 * 4e-31 50.0 %
:HMM:SCOP  2->83 1fjgP_ d.27.1.1 * 6.6e-31 63.4 %
:RPS:PFM   9->67 PF00886 * Ribosomal_S16 4e-15 66.1 %
:HMM:PFM   9->67 PF00886 * Ribosomal_S16 6e-30 64.4 59/62  
:BLT:SWISS 1->91 RS16_LACS1 1e-49 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99440.1 GT:GENE rpsP GT:PRODUCT SSU ribosomal protein S16P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 676236..676511 GB:FROM 676236 GB:TO 676511 GB:DIRECTION + GB:GENE rpsP GB:PRODUCT SSU ribosomal protein S16P GB:NOTE COG0228 [J] Ribosomal protein S16 GB:PROTEIN_ID ABD99440.1 GB:DB_XREF GI:90820801 GB:GENE:GENE rpsP LENGTH 91 SQ:AASEQ MSVKIRLKRMGSKKRPFYRIVVADSRSPRDGRFIETVGTYNPLTDPETVTLKEEKVMNWLNNGAQPSDTVRNILSRNGVMKKFHEAKFSKK GT:EXON 1|1-91:0| SW:ID RS16_LACS1 SW:DE RecName: Full=30S ribosomal protein S16; SW:GN Name=rpsP; OrderedLocusNames=LSL_0630; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->91|RS16_LACS1|1e-49|100.0|91/91| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 3->82|2j00P|8e-19|50.0|80/83| RP:PDB:NREP 1 RP:PDB:REP 3->83|3bbnP|4e-31|46.8|79/80| RP:PFM:NREP 1 RP:PFM:REP 9->67|PF00886|4e-15|66.1|59/62|Ribosomal_S16| HM:PFM:NREP 1 HM:PFM:REP 9->67|PF00886|6e-30|64.4|59/62|Ribosomal_S16| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00886|IPR000307| GO:PFM GO:0005622|"GO:intracellular"|PF00886|IPR000307| GO:PFM GO:0005840|"GO:ribosome"|PF00886|IPR000307| GO:PFM GO:0006412|"GO:translation"|PF00886|IPR000307| RP:SCP:NREP 1 RP:SCP:REP 3->82|1fjgP|4e-31|50.0|80/83|d.27.1.1| HM:SCP:REP 2->83|1fjgP_|6.6e-31|63.4|82/83|d.27.1.1|1/1|Ribosomal protein S16| OP:NHOMO 1065 OP:NHOMOORG 1013 OP:PATTERN -------------------------------------------------------------------- 11111111111111111----11111-----1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111-111111111111-111111111111111111111111111111111111111111-1111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111-11111111111111111111111111111111-111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111-111-1111111111111111111111111111 ------1-----111-11111111111111111-111111111111-11111111--11111111-11--1111--1-111------1----1---1111---112-1-1--2-2-1-1--11111-11351-121-----111111---11111---1--------------133112M1122242231231111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 98.9 SQ:SECSTR #cEEEcccccccTTccccccccEETTcccccccccccccccTTcccEcccccTTTccccTTcccEEcTTTccccTTTTcccccccTTEEEE DISOP:02AL 83-92| PSIPRED ccEEEEEHHcccccccEEEEEEEEcccccccccEEEcccccccccccEEEEcHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHccc //