[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsQ
DDBJ      :rpsQ         SSU ribosomal protein S17P
Swiss-Prot:RS17_LACS1   RecName: Full=30S ribosomal protein S17;

Homologs  Archaea  1/68 : Bacteria  883/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->86 1ripA PDBj 4e-38 90.0 %
:RPS:PDB   8->87 3d5aQ PDBj 3e-23 52.5 %
:RPS:SCOP  9->86 1vs5Q1  b.40.4.5 * 1e-24 53.8 %
:HMM:SCOP  7->85 1fjgQ_ b.40.4.5 * 1.1e-29 60.8 %
:RPS:PFM   13->81 PF00366 * Ribosomal_S17 1e-16 69.6 %
:HMM:PFM   13->80 PF00366 * Ribosomal_S17 2.4e-32 61.8 68/69  
:BLT:SWISS 1->88 RS17_LACS1 4e-46 100.0 %
:PROS 59->71|PS00056|RIBOSOMAL_S17

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00230.1 GT:GENE rpsQ GT:PRODUCT SSU ribosomal protein S17P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1491487..1491753) GB:FROM 1491487 GB:TO 1491753 GB:DIRECTION - GB:GENE rpsQ GB:PRODUCT SSU ribosomal protein S17P GB:NOTE COG0186 [J] Ribosomal protein S17 GB:PROTEIN_ID ABE00230.1 GB:DB_XREF GI:90821591 GB:GENE:GENE rpsQ LENGTH 88 SQ:AASEQ MSESRNQRKVYQGRVVSDKMDKTITVVVETYKNHKVYGKRVKYSKKFKAHDENNEAKVGDIVKIMETRPLSATKRFRLLEIVEKAVIL GT:EXON 1|1-88:0| SW:ID RS17_LACS1 SW:DE RecName: Full=30S ribosomal protein S17; SW:GN Name=rpsQ; OrderedLocusNames=LSL_1426; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->88|RS17_LACS1|4e-46|100.0|88/88| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 59->71|PS00056|RIBOSOMAL_S17|PDOC00055| BL:PDB:NREP 1 BL:PDB:REP 7->86|1ripA|4e-38|90.0|80/81| RP:PDB:NREP 1 RP:PDB:REP 8->87|3d5aQ|3e-23|52.5|80/99| RP:PFM:NREP 1 RP:PFM:REP 13->81|PF00366|1e-16|69.6|69/69|Ribosomal_S17| HM:PFM:NREP 1 HM:PFM:REP 13->80|PF00366|2.4e-32|61.8|68/69|Ribosomal_S17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00366|IPR000266| GO:PFM GO:0005622|"GO:intracellular"|PF00366|IPR000266| GO:PFM GO:0005840|"GO:ribosome"|PF00366|IPR000266| GO:PFM GO:0006412|"GO:translation"|PF00366|IPR000266| RP:SCP:NREP 1 RP:SCP:REP 9->86|1vs5Q1|1e-24|53.8|78/80|b.40.4.5| HM:SCP:REP 7->85|1fjgQ_|1.1e-29|60.8|79/104|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 934 OP:NHOMOORG 906 OP:PATTERN ---------------------------------1---------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111112-1--111111111111111111111111-11111111111112-1111111111-1-111111111111111111111111111---11111--111111111111111-1--1---1-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111-1111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111-1111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-111111-1111111111111111111111111 -----------------------------------------------------------------1------------------------1--1-1---------1---------------------------------------------------------------------11--G112223112-31111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 92.0 SQ:SECSTR ######cccEEEEEEEEcccccEEEEEEEEEEEcTTTccEEEEEEEEEEEcTTccccTTcEEEEEEEEEEETTEEEEEEEEEEcccH# DISOP:02AL 1-6,8-9| PSIPRED ccccccccEEEEEEEEEcccccEEEEEEEEEEEcccccEEEEEEEEEEEEccHHHcccccEEEEEEcccccccEEEEEEEEEEEEEEc //