[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsR
DDBJ      :rpsR         SSU ribosomal protein S18P
Swiss-Prot:RS18_LACS1   RecName: Full=30S ribosomal protein S18;

Homologs  Archaea  0/68 : Bacteria  885/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
a.4.8
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->74 2uuaR PDBj 5e-15 67.3 %
:RPS:PDB   23->78 3bbnR PDBj 3e-24 53.6 %
:RPS:SCOP  13->78 1fjgR  a.4.8.1 * 7e-26 48.5 %
:HMM:SCOP  4->78 1i94R_ a.4.8.1 * 4.2e-25 58.7 %
:RPS:PFM   22->72 PF01084 * Ribosomal_S18 8e-14 76.5 %
:HMM:PFM   20->72 PF01084 * Ribosomal_S18 5.6e-33 69.8 53/54  
:BLT:SWISS 1->78 RS18_LACS1 9e-35 100.0 %
:PROS 25->48|PS00057|RIBOSOMAL_S18
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98832.1 GT:GENE rpsR GT:PRODUCT SSU ribosomal protein S18P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 10121..10357 GB:FROM 10121 GB:TO 10357 GB:DIRECTION + GB:GENE rpsR GB:PRODUCT SSU ribosomal protein S18P GB:NOTE COG0238 [J] Ribosomal protein S18 GB:PROTEIN_ID ABD98832.1 GB:DB_XREF GI:90820193 GB:GENE:GENE rpsR LENGTH 78 SQ:AASEQ MAQQRRGGRRRRKVDYIAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTVAIKRARIMGLLPFVAED GT:EXON 1|1-78:0| SW:ID RS18_LACS1 SW:DE RecName: Full=30S ribosomal protein S18; SW:GN Name=rpsR; OrderedLocusNames=LSL_0009; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->78|RS18_LACS1|9e-35|100.0|78/78| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 25->48|PS00057|RIBOSOMAL_S18|PDOC00056| SEG 5->12|rrggrrrr| BL:PDB:NREP 1 BL:PDB:REP 26->74|2uuaR|5e-15|67.3|49/73| RP:PDB:NREP 1 RP:PDB:REP 23->78|3bbnR|3e-24|53.6|56/58| RP:PFM:NREP 1 RP:PFM:REP 22->72|PF01084|8e-14|76.5|51/54|Ribosomal_S18| HM:PFM:NREP 1 HM:PFM:REP 20->72|PF01084|5.6e-33|69.8|53/54|Ribosomal_S18| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01084|IPR001648| GO:PFM GO:0005622|"GO:intracellular"|PF01084|IPR001648| GO:PFM GO:0005840|"GO:ribosome"|PF01084|IPR001648| GO:PFM GO:0006412|"GO:translation"|PF01084|IPR001648| RP:SCP:NREP 1 RP:SCP:REP 13->78|1fjgR|7e-26|48.5|66/73|a.4.8.1| HM:SCP:REP 4->78|1i94R_|4.2e-25|58.7|75/82|a.4.8.1|1/1|Ribosomal protein S18| OP:NHOMO 921 OP:NHOMOORG 893 OP:PATTERN -------------------------------------------------------------------- 1111111111111121222-22112222222211112222121111111111111111--11112121121111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111-111111111111111111111111-111111111111111111111111111111111111-11111111111112-111111111111111111111111111111111111111111111111--111111111111111111-1111111111111111111111111111111111112111111111111111111111-111111111111111111-1111111111111-111-11111111111111--111111111-1111111-1111111111111111111111111111111111111-1111111111111111111111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111--11111--111111111111111--1 ---------------------------------------------------------------11-------1-------------------------------1---------------------------------------------------------------------1-------1---1-1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 76.9 SQ:SECSTR ##################cccccccccccHHHHTTTccccccccccccTTccTTTTTTTHHHHHHHTTTTcccTTccc DISOP:02AL 1-12,77-79| PSIPRED ccccccccccccccccHHHccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHcccccccccc //