[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsS
DDBJ      :rpsS         SSU ribosomal protein S19P
Swiss-Prot:RS19_LACS1   RecName: Full=30S ribosomal protein S19;

Homologs  Archaea  21/68 : Bacteria  901/915 : Eukaryota  61/199 : Viruses  0/175   --->[See Alignment]
d.28.1
:93 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->88 2gy9S PDBj 1e-31 64.0 %
:RPS:PDB   1->90 3bbnS PDBj 6e-32 55.6 %
:RPS:SCOP  3->84 1fjgS  d.28.1.1 * 4e-32 67.1 %
:HMM:SCOP  2->85 1fjgS_ d.28.1.1 * 1.1e-33 61.9 %
:RPS:PFM   3->83 PF00203 * Ribosomal_S19 4e-27 67.9 %
:HMM:PFM   3->83 PF00203 * Ribosomal_S19 1.1e-40 60.5 81/81  
:BLT:SWISS 1->93 RS19_LACS1 2e-52 100.0 %
:PROS 53->77|PS00323|RIBOSOMAL_S19

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00235.1 GT:GENE rpsS GT:PRODUCT SSU ribosomal protein S19P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1493437..1493718) GB:FROM 1493437 GB:TO 1493718 GB:DIRECTION - GB:GENE rpsS GB:PRODUCT SSU ribosomal protein S19P GB:NOTE COG0185 [J] Ribosomal protein S19 GB:PROTEIN_ID ABE00235.1 GB:DB_XREF GI:90821596 GB:GENE:GENE rpsS LENGTH 93 SQ:AASEQ MSRSLKKGPFVDEHLMKKVEAQADQEKKSVIKTWSRRSTIFPSFIGYTIAVYDGRKHVPVYIQEDMVGHKLGEFVPTRTFHGHGNDDKKTGVR GT:EXON 1|1-93:0| SW:ID RS19_LACS1 SW:DE RecName: Full=30S ribosomal protein S19; SW:GN Name=rpsS; OrderedLocusNames=LSL_1431; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->93|RS19_LACS1|2e-52|100.0|93/93| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 53->77|PS00323|RIBOSOMAL_S19|PDOC00288| BL:PDB:NREP 1 BL:PDB:REP 3->88|2gy9S|1e-31|64.0|86/87| RP:PDB:NREP 1 RP:PDB:REP 1->90|3bbnS|6e-32|55.6|90/92| RP:PFM:NREP 1 RP:PFM:REP 3->83|PF00203|4e-27|67.9|81/81|Ribosomal_S19| HM:PFM:NREP 1 HM:PFM:REP 3->83|PF00203|1.1e-40|60.5|81/81|Ribosomal_S19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00203|IPR002222| GO:PFM GO:0005622|"GO:intracellular"|PF00203|IPR002222| GO:PFM GO:0005840|"GO:ribosome"|PF00203|IPR002222| GO:PFM GO:0006412|"GO:translation"|PF00203|IPR002222| RP:SCP:NREP 1 RP:SCP:REP 3->84|1fjgS|4e-32|67.1|82/84|d.28.1.1| HM:SCP:REP 2->85|1fjgS_|1.1e-33|61.9|84/84|d.28.1.1|1/1|Ribosomal protein S19| OP:NHOMO 999 OP:NHOMOORG 983 OP:PATTERN 111111------------11-11-----1--1-1---------------1111--1--11-----1-- 1111111-11111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-111111111111111-111111111111-1111111111111111111111111111111111111111111111111-11111-11111111111111111111-111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ---------------111---1---------------111111---1111-1-1111-1-1-1--1111-111--111111---1111-1-11-14111-1-1111--------------------------------------------------------------------1111--------1-9112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 96.8 SQ:SECSTR ccccccccccccHHHHHHHHTTTTTTccccEEEccccccccTTcTTccEEEEccccEEEEcccccccccccTTTcccccccccccccccc### DISOP:02AL 1-1,22-24,82-94| PSIPRED ccccccccccccHHHHHHHHHHHccccccEEEEEccccEEcHHHcccEEEEEcccEEEEEEEccccEEcccccccccEEEccccccccccccc //