[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsT
DDBJ      :rpsT         SSU ribosomal protein S20P
Swiss-Prot:RS20_LACS1   RecName: Full=30S ribosomal protein S20;

Homologs  Archaea  0/68 : Bacteria  253/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.7.6
:84 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->84 1vs5T PDBj 2e-12 45.7 %
:RPS:PDB   6->81 3bbnT PDBj 6e-06 43.4 %
:RPS:SCOP  4->84 1vs5T1  a.7.6.1 * 7e-11 44.4 %
:HMM:SCOP  3->85 1fjgT_ a.7.6.1 * 1.7e-19 50.6 %
:HMM:PFM   4->84 PF01649 * Ribosomal_S20p 8.9e-23 46.9 81/84  
:BLT:SWISS 1->84 RS20_LACS1 2e-41 100.0 %
:REPEAT 2|4->27|28->49

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99447.1 GT:GENE rpsT GT:PRODUCT SSU ribosomal protein S20P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(680931..681185) GB:FROM 680931 GB:TO 681185 GB:DIRECTION - GB:GENE rpsT GB:PRODUCT SSU ribosomal protein S20P GB:NOTE COG0268 [J] Ribosomal protein S20 GB:PROTEIN_ID ABD99447.1 GB:DB_XREF GI:90820808 GB:GENE:GENE rpsT LENGTH 84 SQ:AASEQ MPIIKSAIKRVKTTEKANAKNSSQLSKMRTAVKKFEKAKTAGADNVEQLFNEAVSAIDKAQSKGLIKANKAARDKSRMAARLAK GT:EXON 1|1-84:0| SW:ID RS20_LACS1 SW:DE RecName: Full=30S ribosomal protein S20; SW:GN Name=rpsT; OrderedLocusNames=LSL_0637; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->84|RS20_LACS1|2e-41|100.0|84/84| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| NREPEAT 1 REPEAT 2|4->27|28->49| BL:PDB:NREP 1 BL:PDB:REP 4->84|1vs5T|2e-12|45.7|81/85| RP:PDB:NREP 1 RP:PDB:REP 6->81|3bbnT|6e-06|43.4|76/102| HM:PFM:NREP 1 HM:PFM:REP 4->84|PF01649|8.9e-23|46.9|81/84|Ribosomal_S20p| RP:SCP:NREP 1 RP:SCP:REP 4->84|1vs5T1|7e-11|44.4|81/85|a.7.6.1| HM:SCP:REP 3->85|1fjgT_|1.7e-19|50.6|83/99|a.7.6.1|1/1|Ribosomal protein S20| OP:NHOMO 255 OP:NHOMOORG 255 OP:PATTERN -------------------------------------------------------------------- ----1---111----11-----111------1-----111-----1---1-----1----1111111---1-------------------------------------------------------------------------------------------------------------------------1111111111111111111---1111111-1111111111--1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111-------------------1-----1-1-----11111---11--------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------111--11-----------------11------------------------------------------------------------------------1----------------------1----1-------11-111111111-11-1111111111111111111-11111-1-111111111111111-111--111-1--------------------11111-------1---111-111-------------------------------------------1--------------------1111-------------------------1---1--------1--1-------11-------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 96.4 SQ:SECSTR ###cccccHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHTTccccccccTTHHHHHHHHHTTHHHT DISOP:02AL 1-3,13-13,15-20,84-85| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcc //