[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpsU
DDBJ      :rpsU         SSU ribosomal protein S21P
Swiss-Prot:RS21_LACS1   RecName: Full=30S ribosomal protein S21;

Homologs  Archaea  0/68 : Bacteria  146/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:61 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->42 1vs5U PDBj 6e-10 67.6 %
:RPS:PDB   5->43 3bbnU PDBj 8e-07 38.5 %
:HMM:PFM   5->58 PF01165 * Ribosomal_S21 2.2e-25 57.4 54/57  
:BLT:SWISS 1->43 RS21_LACS1 4e-20 100.0 %
:PROS 13->25|PS01181|RIBOSOMAL_S21
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99510.1 GT:GENE rpsU GT:PRODUCT SSU ribosomal protein S21P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 748897..749082 GB:FROM 748897 GB:TO 749082 GB:DIRECTION + GB:GENE rpsU GB:PRODUCT SSU ribosomal protein S21P GB:NOTE COG0828 [J] Ribosomal protein S21 GB:PROTEIN_ID ABD99510.1 GB:DB_XREF GI:90820871 GB:GENE:GENE rpsU LENGTH 61 SQ:AASEQ MSKTVVRKNESLDDALRRFKRSVSKTGTLQEYRKREFYEKPSVKRKKKSEAARKRKNKRRF GT:EXON 1|1-61:0| SW:ID RS21_LACS1 SW:DE RecName: Full=30S ribosomal protein S21; SW:GN Name=rpsU; OrderedLocusNames=LSL_0700; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->43|RS21_LACS1|4e-20|100.0|43/61| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 13->25|PS01181|RIBOSOMAL_S21|PDOC00909| SEG 44->60|krkkkseaarkrknkrr| BL:PDB:NREP 1 BL:PDB:REP 6->42|1vs5U|6e-10|67.6|37/51| RP:PDB:NREP 1 RP:PDB:REP 5->43|3bbnU|8e-07|38.5|39/53| HM:PFM:NREP 1 HM:PFM:REP 5->58|PF01165|2.2e-25|57.4|54/57|Ribosomal_S21| OP:NHOMO 146 OP:NHOMOORG 146 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-11111111111111111111-1111111111-1-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11------------1---11111-1--111--11-1----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 41 STR:RPRED 67.2 SQ:SECSTR ##ccccccccccccccccccTTTTTTHHHHcccccccTTTTTT################## DISOP:02AL 1-1,41-62| PSIPRED ccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccc //