[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rsuA
DDBJ      :rsuA         Ribosomal small subunit pseudouridine synthase A
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  865/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:240 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->220 1kskA PDBj 3e-32 40.3 %
:RPS:PDB   3->221 3dh3B PDBj 1e-35 27.3 %
:RPS:SCOP  4->61 1kskA3  d.66.1.5 * 7e-12 36.8 %
:RPS:SCOP  64->220 1kskA4  d.265.1.3 * 2e-34 41.3 %
:HMM:SCOP  3->105 1fjgD_ d.66.1.2 * 7.2e-17 37.8 %
:HMM:SCOP  61->241 1vioA1 d.265.1.3 * 1.6e-39 33.3 %
:RPS:PFM   67->196 PF00849 * PseudoU_synth_2 8e-13 36.7 %
:HMM:PFM   65->199 PF00849 * PseudoU_synth_2 2.8e-26 27.4 135/164  
:HMM:PFM   3->45 PF01479 * S4 2.4e-13 39.5 43/48  
:BLT:SWISS 3->221 RSUA_YERPE 2e-42 45.5 %
:PROS 103->117|PS01149|PSI_RSU
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99255.1 GT:GENE rsuA GT:PRODUCT Ribosomal small subunit pseudouridine synthase A GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 494432..495154 GB:FROM 494432 GB:TO 495154 GB:DIRECTION + GB:GENE rsuA GB:PRODUCT Ribosomal small subunit pseudouridine synthase A GB:NOTE COG1187 [J] 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases GB:PROTEIN_ID ABD99255.1 GB:DB_XREF GI:90820616 GB:GENE:GENE rsuA LENGTH 240 SQ:AASEQ MYMRLDKFLSQTGKFTRAEAKKVIKAKRVRLNDEVVKDGKIKINEESDKIFLDGELLALNNKEVYYMLNKPAGVVSATRDDKDKTVIDLINFPGRKEDLFPVGRLDKETTGLLIITNDGKFAHDIISPKKHVSKTYEAVVTGKISEKEVKIFSQGMELSNGDKLQPAQLDIISYSEKDDTSKVRVIIHEGKYHQVRRMFGAVSQRVLELDRVKIGLLELDDTLERGEYRELTEEELNLIK GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 3->221|RSUA_YERPE|2e-42|45.5|211/235| PROS 103->117|PS01149|PSI_RSU|PDOC00885| SEG 222->238|tlergeyrelteeelnl| BL:PDB:NREP 1 BL:PDB:REP 4->220|1kskA|3e-32|40.3|206/230| RP:PDB:NREP 1 RP:PDB:REP 3->221|3dh3B|1e-35|27.3|209/241| RP:PFM:NREP 1 RP:PFM:REP 67->196|PF00849|8e-13|36.7|128/149|PseudoU_synth_2| HM:PFM:NREP 2 HM:PFM:REP 65->199|PF00849|2.8e-26|27.4|135/164|PseudoU_synth_2| HM:PFM:REP 3->45|PF01479|2.4e-13|39.5|43/48|S4| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 4->61|1kskA3|7e-12|36.8|57/59|d.66.1.5| RP:SCP:REP 64->220|1kskA4|2e-34|41.3|150/172|d.265.1.3| HM:SCP:REP 3->105|1fjgD_|7.2e-17|37.8|98/208|d.66.1.2|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 61->241|1vioA1|1.6e-39|33.3|174/0|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 2022 OP:NHOMOORG 895 OP:PATTERN -------------------------------------------------------------------- 1221111111111111111-11111111111111111111111111111111111111--11111111111-1111111111121222111111-11--21333133312-1111111-11111111111111111111111111122122212122221112112122221211111211111112222-222-4444444344444422222244422232332222223332222222222222222222-21222212222211222222213333333333322333333333333333333333333333333333323324222222242422223344232232221111121111222222-23211333311111121111111111111111111111-3322222212112111222222221143121111112221111111111111322------------1111111111111-----1212-2222243343444444444344444444443443333333344422331433454443334333322243421113111111111111111111111113111211111111111111111112111233442355624545666677755556-77577--211121--11143333444443444444-4444444444444444444444333344444444444444443544434442-433343333444--2211111222224224333333333333213333333344333333333333-3333333111111111354464444444544554434433322221112221111111111112-311111-21111--11111--12--13212322222123 11--22--2---------------------------------------------------------------------------------------------------62-----------------------------------------------------2---------1-1-24C4431111-1-113342222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 92.1 SQ:SECSTR HHEEHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEETTEEEccccGGGccEEEEEEcTTcccccccccTTcHHHHHTccccccccEEccccccccEEEEEEEccTHHHHHHHcGGGcccEEEEEEEcccccHHHHHHHHTcccccccccccccEEEEcccEEEEcccEEEEEEccccTTHHHHHHHHTTccEEEEEEEEETTEEcTT################### DISOP:02AL 240-241| PSIPRED cHHHHHHHHHHcccccHHHHHHHHHcccEEEccEEEEEccEEEcccccEEEEEccccccccccEEEEEEccccEEEcccccccccEEEEEccccccccEEEcccccccccEEEEEEccHHHHHHHHHHHccccEEEEEEEcccccHHHHHHcccccEEEcccEEEEEEEEEEEEcccccEEEEEEEEEEcccHHHHHHHHHcccEEEEEEEEEEEEEEcccccccccHHHccHHHHcccc //