[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : terC
DDBJ      :terC         Tellurium resistance protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  121/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:241 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   32->208 PF03741 * TerC 5e-16 35.4 %
:HMM:PFM   32->208 PF03741 * TerC 1.4e-55 36.4 176/184  
:BLT:SWISS 1->239 YCEF_BACSU 2e-43 45.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00423.1 GT:GENE terC GT:PRODUCT Tellurium resistance protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1706374..1707099) GB:FROM 1706374 GB:TO 1707099 GB:DIRECTION - GB:GENE terC GB:PRODUCT Tellurium resistance protein GB:NOTE COG0861 [P] Membrane protein TerC, possibly involved in tellurium resistance GB:PROTEIN_ID ABE00423.1 GB:DB_XREF GI:90821784 GB:GENE:GENE terC LENGTH 241 SQ:AASEQ MDILQQLYGPFFDANNWRTVVTSGEDWMIILSLVLIECLLSVDNAIVLAAQTQVLPDKKQQEKSLFYGLWGAYIFRFILIGLGAYLIHFWEIKVAGAAYLMYLAVSHFYRKKNPKPKKDGKKAKKRILPLFWSVVVSIEMMDIVFSVDSVLASLAISPNPVIVLIGGLIGILAMRGIAEIIMRLMEIVPELETTAYGLIALIAIKLFLTIPMIDIEIPNLLFGIIVLGSIVATFIIHRIKN GT:EXON 1|1-241:0| BL:SWS:NREP 1 BL:SWS:REP 1->239|YCEF_BACSU|2e-43|45.3|236/257| TM:NTM 6 TM:REGION 29->51| TM:REGION 69->91| TM:REGION 129->151| TM:REGION 163->185| TM:REGION 192->214| TM:REGION 217->238| SEG 111->125|kknpkpkkdgkkakk| SEG 164->172|liggligil| RP:PFM:NREP 1 RP:PFM:REP 32->208|PF03741|5e-16|35.4|175/178|TerC| HM:PFM:NREP 1 HM:PFM:REP 32->208|PF03741|1.4e-55|36.4|176/184|TerC| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03741|IPR005496| OP:NHOMO 155 OP:NHOMOORG 121 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------11------11-------------------1111---1-----11---1-1--21121111------1111111------1----1111--1----12222222222222222212212222---21212222221-2111111111111111--1--11-11-1111111111111-----------------------------------------------------1-------------------------------11------------------------------------------------------------------------1-------------------------------------------------------------------------11111-----11-------1----1---1------------1---------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 111-128| PSIPRED ccHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcc //