[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : tig
DDBJ      :tig          Trigger factor, ppiase
Swiss-Prot:TIG_LACS1    RecName: Full=Trigger factor;         Short=TF;

Homologs  Archaea  0/68 : Bacteria  868/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
a.223.1d.241.2d.26.1
:436 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->392 1t11A PDBj 5e-52 34.4 %
:RPS:PDB   12->111 2d3o1 PDBj 9e-25 23.2 %
:RPS:PDB   130->254 3chxA PDBj 4e-28 12.9 %
:RPS:SCOP  56->250 1fd9A  d.26.1.1 * 4e-35 20.0 %
:RPS:SCOP  251->411 1w26A1  a.223.1.1 * 1e-24 17.3 %
:HMM:SCOP  1->131 1t11A2 d.241.2.1 * 8.6e-40 44.2 %
:HMM:SCOP  89->246 1fd9A_ d.26.1.1 * 4.7e-42 35.4 %
:HMM:SCOP  251->437 1w26A1 a.223.1.1 * 2.1e-39 43.4 %
:RPS:PFM   1->146 PF05697 * Trigger_N 2e-24 46.9 %
:RPS:PFM   162->244 PF00254 * FKBP_C 5e-11 42.2 %
:RPS:PFM   266->419 PF05698 * Trigger_C 1e-17 44.4 %
:HMM:PFM   1->147 PF05697 * Trigger_N 1.2e-47 40.0 145/145  
:HMM:PFM   265->422 PF05698 * Trigger_C 6.2e-45 40.8 157/162  
:HMM:PFM   158->240 PF00254 * FKBP_C 7.5e-21 38.6 83/96  
:BLT:SWISS 1->436 TIG_LACS1 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99453.1 GT:GENE tig GT:PRODUCT Trigger factor, ppiase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 687160..688470 GB:FROM 687160 GB:TO 688470 GB:DIRECTION + GB:GENE tig GB:PRODUCT Trigger factor, ppiase GB:NOTE COG0544 [O] FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) GB:PROTEIN_ID ABD99453.1 GB:DB_XREF GI:90820814 GB:GENE:GENE tig LENGTH 436 SQ:AASEQ MSIKWEKKDGTNEGKLTFEIAPEKIKEGLNSAFNRVKKSLNVPGFRKGKVPRQIFNKMYGEEALYQEALNDLLPEAYSNAVKEADINPVDQPQIDVESMESDAAWVLTAKVTVEPEVELGQYKDLEVTKHPTRVLKADIENELNRLQQQEAELVLKEDEPAEQGDTVVIDFEGKIDGEAFDGGKGENHSLELGSGQFIPGFEDQLVGHKAGEEVAVTVTFPEDYQAKDLAGKEAVFDTKIHEVKTKELPELDDEFAKDVDEDVATLEELKAKIKDRLKDQKVAEAKAAIQEEALDIAVENATIGEIPAVMIEDDVHRQMDNFLAGMQNQGISADMYYQLTGTSADDLHKQFEEGAEKRVKTNLVLEAIVKAEKIEPSEDEINAEIKSLAEQYQMDEAAVRSALSDDMLKHDIAVRKVVDEIADSAKQTRDAKKDEE GT:EXON 1|1-436:0| SW:ID TIG_LACS1 SW:DE RecName: Full=Trigger factor; Short=TF; SW:GN Name=tig; OrderedLocusNames=LSL_0643; SW:KW Cell cycle; Cell division; Chaperone; Complete proteome; Isomerase;Rotamase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->436|TIG_LACS1|0.0|100.0|436/436| GO:SWS:NREP 5 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0003755|"GO:peptidyl-prolyl cis-trans isomerase activity"|Rotamase| GO:SWS GO:0006457|"GO:protein folding"|Rotamase| BL:PDB:NREP 1 BL:PDB:REP 1->392|1t11A|5e-52|34.4|372/376| RP:PDB:NREP 2 RP:PDB:REP 12->111|2d3o1|9e-25|23.2|99/100| RP:PDB:REP 130->254|3chxA|4e-28|12.9|124/362| RP:PFM:NREP 3 RP:PFM:REP 1->146|PF05697|2e-24|46.9|145/146|Trigger_N| RP:PFM:REP 162->244|PF00254|5e-11|42.2|83/91|FKBP_C| RP:PFM:REP 266->419|PF05698|1e-17|44.4|153/161|Trigger_C| HM:PFM:NREP 3 HM:PFM:REP 1->147|PF05697|1.2e-47|40.0|145/145|Trigger_N| HM:PFM:REP 265->422|PF05698|6.2e-45|40.8|157/162|Trigger_C| HM:PFM:REP 158->240|PF00254|7.5e-21|38.6|83/96|FKBP_C| GO:PFM:NREP 5 GO:PFM GO:0006457|"GO:protein folding"|PF05697|IPR008881| GO:PFM GO:0015031|"GO:protein transport"|PF05697|IPR008881| GO:PFM GO:0006457|"GO:protein folding"|PF00254|IPR001179| GO:PFM GO:0006457|"GO:protein folding"|PF05698|IPR008880| GO:PFM GO:0015031|"GO:protein transport"|PF05698|IPR008880| RP:SCP:NREP 2 RP:SCP:REP 56->250|1fd9A|4e-35|20.0|185/204|d.26.1.1| RP:SCP:REP 251->411|1w26A1|1e-24|17.3|150/185|a.223.1.1| HM:SCP:REP 1->131|1t11A2|8.6e-40|44.2|129/129|d.241.2.1|1/1|Trigger factor ribosome-binding domain| HM:SCP:REP 89->246|1fd9A_|4.7e-42|35.4|158/204|d.26.1.1|1/1|FKBP-like| HM:SCP:REP 251->437|1w26A1|2.1e-39|43.4|173/0|a.223.1.1|1/1|Triger factor/SurA peptide-binding domain-like| OP:NHOMO 915 OP:NHOMOORG 885 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111112111-111111-1-------1111-1--11--------------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111411111341125111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111113111111111111-11111111111111111111-111111111111111111111111111-111111-----11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1111111-1111111111111-111111111111111111111111-1-1-111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111181111-3112-11-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 385 STR:RPRED 88.3 SQ:SECSTR cEEEEEEccTTccEEEEEcccGGGTHHHHHHHHHHHHTTcccTTccTTccccTTHHHHTTTTccHHHHHHHHHHHHHHHHHHHccccccccEEcccccccccccccEEEEEEcccccccTTcTTcEEEccccccccccccccccccccccEccccEEEcccccEEEEcccccccccTTccccTTccTTccccccccccTTccccccEEEEccHHHHTTcGGGGcccccccccEEEEcccccccEEEEcccccEEEccccccTTTHcccccEEEEEEETTEEEEEcccTTTTccEEEEEEEEEEEEccHHHHHTccccHHHTTTTHHHHccccHHHHTTcc#######GGGTHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHcc############################################ DISOP:02AL 327-330,332-337,340-340,430-437| PSIPRED ccEEEEEEccccEEEEEEEEcHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEccccccEEEEEEEEccccccccccccccEEEEEEEEccHHHHHHHHHHHHHHccccEEccccHHccccEEEEEEEEEEccEEccccccccEEEEEccccccHHHHHHccccccccEEEEEEcccHHcccccccccEEEEEEEEEEEEEcccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEccccccc //