[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : treC
DDBJ      :treC         Trehalose-6-phosphate hydrolase
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  604/915 : Eukaryota  124/199 : Viruses  0/175   --->[See Alignment]
b.71.1c.1.8
:553 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->553 1uokA PDBj e-136 43.9 %
:RPS:PDB   8->552 3czkA PDBj 6e-78 19.0 %
:RPS:SCOP  8->470 1m53A2  c.1.8.1 * 4e-99 39.3 %
:RPS:SCOP  473->553 1m53A1  b.71.1.1 * 7e-14 26.0 %
:HMM:SCOP  1->470 1m53A2 c.1.8.1 * 1.2e-127 37.7 %
:HMM:SCOP  473->554 1m53A1 b.71.1.1 * 1.4e-14 39.7 %
:RPS:PFM   34->367 PF00128 * Alpha-amylase 1e-36 42.4 %
:HMM:PFM   26->372 PF00128 * Alpha-amylase 8.5e-94 39.9 313/316  
:HMM:PFM   481->552 PF02806 * Alpha-amylase_C 0.00014 23.5 68/93  
:BLT:SWISS 8->553 TREC_BACSU e-158 48.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00318.1 GT:GENE treC GT:PRODUCT Trehalose-6-phosphate hydrolase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1570828..1572489 GB:FROM 1570828 GB:TO 1572489 GB:DIRECTION + GB:GENE treC GB:PRODUCT Trehalose-6-phosphate hydrolase GB:NOTE COG0366 [G] Glycosidases GB:PROTEIN_ID ABE00318.1 GB:DB_XREF GI:90821679 GB:GENE:GENE treC LENGTH 553 SQ:AASEQ MTKLGQKVIYQIYPKSFYDSNNDGFGDLKGIIAKIDYLKKLNIDMIWFNPFYVSPQNDNGYDIADYYKIDERFGTMEDFEEMVAKLKEANIGVMLDMVLNHCSTEHEWFQKALAGDEKYQKYFYLRPAKEDGSLPTNWQSKFGGPAWEKFGDTDLYYLHLYDKTQADLDWHNPDVRAEAAKIVNFWKEKGVAGFRFDVLNVIGKDEVLVDSVDPDHEKPLYTDTPVVHKYIKELNRNTFGTDPEIVTVGEMSSTTIPNSIEYTNPDEHELSMVFTFHHLKVDYDNGEKWSKVPFNFMELKSLLSTWQTEMDKGNGWNALFWNNHDQPWALNRFGDPVNYREKSAEMLATTLHLLRGTPYIYMGEELGMMDPHYKSIDDYVDVEALNGYQMLLDKGVDKDRAFEIVVSKSRDNSRVPMHWDDSKYAGFSEAKPWLIPTDQDEINVEKELTSGEIFNHYQKLIKLRKTEPLIYAGHFKELLADNKQVFAHERYLDNSPEKLVVFNNFYGTEVTVDLPAEYQDKDCTTLVDNYQNEIQKTAKQITLQPYESLAIKI GT:EXON 1|1-553:0| BL:SWS:NREP 1 BL:SWS:REP 8->553|TREC_BACSU|e-158|48.7|542/561| BL:PDB:NREP 1 BL:PDB:REP 6->553|1uokA|e-136|43.9|542/558| RP:PDB:NREP 1 RP:PDB:REP 8->552|3czkA|6e-78|19.0|504/618| RP:PFM:NREP 1 RP:PFM:REP 34->367|PF00128|1e-36|42.4|264/296|Alpha-amylase| HM:PFM:NREP 2 HM:PFM:REP 26->372|PF00128|8.5e-94|39.9|313/316|Alpha-amylase| HM:PFM:REP 481->552|PF02806|0.00014|23.5|68/93|Alpha-amylase_C| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00128|IPR006047| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00128|IPR006047| GO:PFM GO:0043169|"GO:cation binding"|PF00128|IPR006047| RP:SCP:NREP 2 RP:SCP:REP 8->470|1m53A2|4e-99|39.3|461/478|c.1.8.1| RP:SCP:REP 473->553|1m53A1|7e-14|26.0|77/78|b.71.1.1| HM:SCP:REP 1->470|1m53A2|1.2e-127|37.7|467/478|c.1.8.1|1/1|(Trans)glycosidases| HM:SCP:REP 473->554|1m53A1|1.4e-14|39.7|78/78|b.71.1.1|1/1|Glycosyl hydrolase domain| OP:NHOMO 1961 OP:NHOMOORG 747 OP:PATTERN --1-1---1---11--2-------3--4213-------------------1----2-232-211---- 35-27122222-1-12222-22--2322222123331133142242423221468214--1132413764244332432--12-----1121-4-----312-244153----------------121221112-256566---82477111111--22221121-21111-111-1-1-11-8762412-273555555453545554244415554555-367577575-332222222222222211132452-58-1525AA2257242442655222433322223333433232422224444222223322-333231-152222222727-422-4445-13--27-111-1--61-133231-2--22221-----1233111-22222------------21511423322-2224542354332152122-333311---------1---1-32------------------------------31-1--1-11111-111111111131-111-111111---1114-1-----15---112-21----------322-1-1--111-------111-211-1341312-----------------------------3344-32-3362322223-222-21-2--2---2---------36--1212222222222-22222223222222222223432111-22-122222222321231112221--222222222222-------------1-615----31-------------------4911311212211114111---------1133311111345562133333122------11221111--------1-5----1---1-3-----21--31---466334144312- ----211-------1444435556252-------------------1123687844122222-22-2441--3-5875F9-22225-1-3-1422121211-1--1--21611111---1--11111116B1-11411-11-11111---1111-112124628547BBGG1224---1A-------1-3----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 553 STR:RPRED 100.0 SQ:SECSTR cccTTcTGGGcTTccEEEEcHHHHHccHHHHHHTHHHHHHHTccEEEEcccEEEcccccTTcEEEEEEEcTTTccHHHHHHHHHHHHHTTcEEEEEccccEEETTcHHHHHHHTTcHHHHTTccEHHHHHHHHHcccccTTTccccEEEETTTTEEEEccccTTEEEccTTcHHHHHHHHHHHHHHHHTTccEEEETTTTcccccTTccGGccccccTTcccccHHHHHHHHHHHHHHHHHcTTcEEEEcccccGGGcGGGGccGGGccccEEEcHHHHHHHHHHHHHTHHHHTcTHHHHHHHHTcccccTTcTcEEEEEccccccEEGGGGHHHHcHHHHHHTcccccccccHHHHHHHHHTccTTcccccEEEccccEEEcHHTTHHHHHHTTHHHHHTHHHHHHHHHHccEEEEEETTGGGTccccGcGGGGGcccccHHHHHTTcTTcHHHHHHHHHHHHHTcGGGcTTcEEEcccccTTEEEEEETcccETTTEEEEEEcccccEEEcGGGTTcTcccEEccccccccccEEcccEEEcTTcEEEEEE DISOP:02AL 1-1| PSIPRED cccccccEEEEEEccccccccccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHcccccccccEEEccccccccccccccccccccccccccccccEEEccccccccccccccHHHHHHHHHHHHHHHHccccEEEEcccHHcccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHccccccEEEEcccHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccHHcccHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccEEEEEEEEcccccEEEEEEEcccccEEEEcccccccccEEEEEccccccccccccEEEEccccEEEEEc //