[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : treR
DDBJ      :treR         Trehalose operon transcriptional repressor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  370/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.190.1
:237 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->65 2di3B PDBj 2e-07 36.7 %
:BLT:PDB   124->236 2oggA PDBj 6e-23 50.0 %
:RPS:PDB   1->228 3eetA PDBj 9e-30 17.0 %
:RPS:SCOP  3->71 1e2xA1  a.4.5.6 * 5e-18 30.4 %
:RPS:SCOP  79->228 2ooiA1  d.190.1.2 * 2e-24 21.3 %
:HMM:SCOP  1->106 1v4rA1 a.4.5.6 * 1.2e-14 31.6 %
:HMM:SCOP  78->229 2fa1A1 d.190.1.2 * 8.8e-28 29.6 %
:RPS:PFM   7->68 PF00392 * GntR 8e-08 37.1 %
:RPS:PFM   124->226 PF07702 * UTRA 5e-10 34.0 %
:HMM:PFM   93->227 PF07702 * UTRA 3.4e-27 30.4 135/141  
:HMM:PFM   6->68 PF00392 * GntR 3.5e-18 33.3 63/64  
:BLT:SWISS 1->236 TRER_BACSU 7e-51 48.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00317.1 GT:GENE treR GT:PRODUCT Trehalose operon transcriptional repressor GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1570096..1570809 GB:FROM 1570096 GB:TO 1570809 GB:DIRECTION + GB:GENE treR GB:PRODUCT Trehalose operon transcriptional repressor GB:NOTE COG1522 [K] Transcriptional regulators GB:PROTEIN_ID ABE00317.1 GB:DB_XREF GI:90821678 GB:GENE:GENE treR LENGTH 237 SQ:AASEQ MVQSKHDMIAQDIASKIKYHQYKEGDYLPSEHQLCELYGTSRETIRKALNHLTELGLIQKIRGKGSVVLDIQKFTFPISGITSFKELNRSLNMHAKTTVLKQVNTLAPKKFMDINIDNQQAIFVERLRTIDDLPVVLDQDYLLTPPVSSLPAGVAEDSIYEYLEKELHLEVSYATKAITVEKAADDIAEKLQLDDDKLVVIVRSLSYLDDTTLFQLTSSYHRPDKFKFIDFARRKKI GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 1->236|TRER_BACSU|7e-51|48.1|235/238| BL:PDB:NREP 2 BL:PDB:REP 6->65|2di3B|2e-07|36.7|60/230| BL:PDB:REP 124->236|2oggA|6e-23|50.0|112/143| RP:PDB:NREP 1 RP:PDB:REP 1->228|3eetA|9e-30|17.0|224/238| RP:PFM:NREP 2 RP:PFM:REP 7->68|PF00392|8e-08|37.1|62/64|GntR| RP:PFM:REP 124->226|PF07702|5e-10|34.0|100/141|UTRA| HM:PFM:NREP 2 HM:PFM:REP 93->227|PF07702|3.4e-27|30.4|135/141|UTRA| HM:PFM:REP 6->68|PF00392|3.5e-18|33.3|63/64|GntR| GO:PFM:NREP 6 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| GO:PFM GO:0003677|"GO:DNA binding"|PF07702|IPR011663| GO:PFM GO:0030528|"GO:transcription regulator activity"|PF07702|IPR011663| GO:PFM GO:0045449|"GO:regulation of transcription"|PF07702|IPR011663| RP:SCP:NREP 2 RP:SCP:REP 3->71|1e2xA1|5e-18|30.4|69/73|a.4.5.6| RP:SCP:REP 79->228|2ooiA1|2e-24|21.3|150/157|d.190.1.2| HM:SCP:REP 1->106|1v4rA1|1.2e-14|31.6|95/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 78->229|2fa1A1|8.8e-28|29.6|152/0|d.190.1.2|1/1|Chorismate lyase-like| OP:NHOMO 980 OP:NHOMOORG 371 OP:PATTERN -------------------------------------------------------------------- --1-21--------1--11-1---1-1111112----1321-------------1--------1--1-----------3---2-------1-----------------11---------------------------------------------------------------------------1-----1254444335524444446555564443453445677876--1222222222222211--11663249227475522755364333321113222222333333333333333333332333243221444312-28222222232515--2222---1-1----34-2--3---12111-3---1---------------------33333332333---1-----11--311111111122-----111----111-----------------------------------------------1-------2333333121222222222222423-11-------2------------1--12---------------------------2--------------1------------------------------221-2------------1-------------------------3431-314442421265-444532154542233433354533---423434344434444414323334--222232222233---------------11-----1----------11121------111112223-1--2-------------------------1----11111111-------1-------------------------------------------23---5-1-1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------8---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 99.6 SQ:SECSTR ccccHHHHHHHHHHHHHHHTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHTTTcEEEcccEEcccEEEEccccccccccHHcHHHcccTTccEEEEEEEEEEEccHHHHHHTHTccTTcEEEEEEEEEETTEEEEEEEEEHHHHTTcTTcTTccTTTTcHHHHTTccccEEEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEEEETTEEEEEEEEEEETTTEEEcccccccc# DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccEEEEcccccHHHHHHHHccHHHHHHHcccccEEEEEEEHHcccHHHHHHHcccHHHHHHHHHHHHHccEEEEEEEEcccHHHHccccHHHHcccHHHHHHHHccccEEEEEEEEEEEEccHHHHHHcccccccEEEEEEEEEEcccccEEEEEEEEEcccEEEEEEEEEEccc //