[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : trmU
DDBJ      :trmU         tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Swiss-Prot:MNMA_LACS1   RecName: Full=tRNA-specific 2-thiouridylase mnmA;         EC=2.8.1.-;

Homologs  Archaea  0/68 : Bacteria  897/915 : Eukaryota  129/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:375 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->375 2hmaA PDBj e-122 67.6 %
:RPS:PDB   23->369 2detA PDBj e-106 55.5 %
:RPS:SCOP  23->271 1jgtA1  c.26.2.1 * 9e-32 9.1 %
:HMM:SCOP  8->245 2c5sA1 c.26.2.6 * 3e-62 42.0 %
:RPS:PFM   23->362 PF03054 * tRNA_Me_trans e-124 64.4 %
:HMM:PFM   8->362 PF03054 * tRNA_Me_trans 9.5e-148 51.6 351/356  
:BLT:SWISS 1->375 MNMA_LACS1 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99672.1 GT:GENE trmU GT:PRODUCT tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 881042..882169 GB:FROM 881042 GB:TO 882169 GB:DIRECTION + GB:GENE trmU GB:PRODUCT tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase GB:NOTE COG0482 [J] Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain GB:PROTEIN_ID ABD99672.1 GB:DB_XREF GI:90821033 GB:GENE:GENE trmU LENGTH 375 SQ:AASEQ MKDKSQIRVVVGMSGGVDSSVSAYLLKQQGYDVVGVFMKNWDDKNDSGVCTVTEDYQDVAKVASQIGIPYYSVNFEKEYWDRVFTYFLDEYKNGRTPNPDIMCNKEVKFKAFLDYAMSIDADYIAMGHYAQLRRDEDGRVHLLRGADDNKDQTYFLSQLSQEQLQKVMFPIGHLQKSEVRRIAEEAGLATAKKKDSTGICFIGERNFSKFLGEFLPAQPGEMVTLDGEVKGNHFGLMNYTIGQRKGLGIGGDGKSNEPWFVIGKDLKTNTLLVGQGYHNEHLYANSLDASKLSFVDDISDCGDEFHCTAKFRYRQKDTGVTVKFNEDRTKVEVIFDEPVRAITPGQEVVFYDGEECLGSGTIDHAYKESKLLQYV GT:EXON 1|1-375:0| SW:ID MNMA_LACS1 SW:DE RecName: Full=tRNA-specific 2-thiouridylase mnmA; EC=2.8.1.-; SW:GN Name=mnmA; Synonyms=trmU; OrderedLocusNames=LSL_0862; SW:KW ATP-binding; Complete proteome; Cytoplasm; Disulfide bond;Nucleotide-binding; RNA-binding; Transferase; tRNA processing;tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->375|MNMA_LACS1|0.0|100.0|375/375| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| SEG 9->22|vvvgmsggvdssvs| BL:PDB:NREP 1 BL:PDB:REP 23->375|2hmaA|e-122|67.6|333/353| RP:PDB:NREP 1 RP:PDB:REP 23->369|2detA|e-106|55.5|344/365| RP:PFM:NREP 1 RP:PFM:REP 23->362|PF03054|e-124|64.4|331/348|tRNA_Me_trans| HM:PFM:NREP 1 HM:PFM:REP 8->362|PF03054|9.5e-148|51.6|351/356|tRNA_Me_trans| RP:SCP:NREP 1 RP:SCP:REP 23->271|1jgtA1|9e-32|9.1|230/290|c.26.2.1| HM:SCP:REP 8->245|2c5sA1|3e-62|42.0|207/0|c.26.2.6|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 1141 OP:NHOMOORG 1026 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111-------111111111133331111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111121111111111111111111111111111111---1111111111111111111111111111111111111111111111111111222222212111111111121111111111111111112221122121111111111111111111111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111212111111111111212111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111-111111-11111111111111111111111111111111 ----111-311---1-----------------------------------------------11111111111111111111111111-111-11111111-1111-22122111121111-1112-318B1-3121111311111111-11-2121121--1311-114A11-32112I222223121-11222121- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 353 STR:RPRED 94.1 SQ:SECSTR ######################HHHHHHHccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHTcccccccTHHHHHHHTHHHHHHHHHTTccccTHHHHHHHTTTTHHHHHHHTccccEEEcccccEHEEEETTEEEEEccccGGGccGGGGGcccTHHHHHEEccGGGccHHHHHHHHHHHTcTTcccccccccTTcccccHHHHHTTTccccccccccTTccccccccccTTccTTccccccccccccccccEEEEEccTTTTccEEEEcTTcGGGEEEEEEEEccccTTcccccccEEEEEEEccTTcccEEEEEEcccccccEEEEEEEEEETccTTcEEEEEETTEEEEEEEEEEEEEcccccTTc DISOP:02AL 1-5,8-8| PSIPRED cccHHHcEEEEEEcccccHHHHHHHHHHcccEEEEEEEEEccccccccccccHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHHcccccccHHHccccccHHHHHHHHHHccccEEEEccEEEEEEccccEEEEEEEccccccEEEEEccccHHHHHHHHcccccccHHHHHHHHHHcccccccccccccEEEcccccHHHHHHHHccccccEEEcccccEEEEEEEEEEEEccccccccccccccccccEEEEEEEccccEEEEEEccccHHHHccEEEEEEEEEccccccccccEEEEEEEEEccccEEEEEEEEccccEEEEEEccccccccccEEEEEEEccEEEEEEEEEEEEcccHHcccc //