[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : troR
DDBJ      :troR         Iron-dependent repressor
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  287/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.76.1
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->215 3hrsA PDBj 5e-25 31.1 %
:RPS:PDB   1->131 1bi3B PDBj 8e-12 29.2 %
:RPS:PDB   147->215 3e19C PDBj 3e-05 25.8 %
:RPS:SCOP  2->50 1on1A1  a.4.5.24 * 2e-10 40.8 %
:RPS:SCOP  62->130 1b1bA2  a.76.1.1 * 1e-22 39.1 %
:HMM:SCOP  1->61 1on2A1 a.4.5.24 * 4e-12 34.4 %
:HMM:SCOP  62->137 1g3sA2 a.76.1.1 * 5.1e-24 48.7 %
:RPS:PFM   1->59 PF01325 * Fe_dep_repress 4e-08 44.1 %
:RPS:PFM   62->126 PF02742 * Fe_dep_repr_C 4e-15 55.4 %
:HMM:PFM   62->132 PF02742 * Fe_dep_repr_C 1.1e-32 54.9 71/71  
:HMM:PFM   2->58 PF01325 * Fe_dep_repress 5.6e-19 42.1 57/60  
:HMM:PFM   144->215 PF04023 * FeoA 6.1e-14 34.3 70/74  
:BLT:SWISS 45->130 Y069_CHLTR 3e-16 48.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00285.1 GT:GENE troR GT:PRODUCT Iron-dependent repressor GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1538693..1539340) GB:FROM 1538693 GB:TO 1539340 GB:DIRECTION - GB:GENE troR GB:PRODUCT Iron-dependent repressor GB:NOTE COG1321 [K] Mn-dependent transcriptional regulator GB:PROTEIN_ID ABE00285.1 GB:DB_XREF GI:90821646 GB:GENE:GENE troR LENGTH 215 SQ:AASEQ MTPKKEDYLKIIFELGGTKKKVSNKQIAMSLNVAAGSVTEMVNKLVKEGLAAHTPYAGISLTDEGIEVAEKLVRRHRLWETFLVEKLDYQLSEVHDEAEVLEHVASDKLMKKLDQFLNSPRECPHGGVIPTEAGEYEEESHEYLAEIKVGETVEVDRFIDNHELLTYLDDLELKLGDKIEVLEHLPFEGPIKVKRLADGAELSIGYKAAHYIFVK GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 45->130|Y069_CHLTR|3e-16|48.2|85/451| SEG 132->146|eageyeeesheylae| SEG 163->175|elltylddlelkl| BL:PDB:NREP 1 BL:PDB:REP 2->215|3hrsA|5e-25|31.1|212/214| RP:PDB:NREP 2 RP:PDB:REP 1->131|1bi3B|8e-12|29.2|130/136| RP:PDB:REP 147->215|3e19C|3e-05|25.8|66/77| RP:PFM:NREP 2 RP:PFM:REP 1->59|PF01325|4e-08|44.1|59/59|Fe_dep_repress| RP:PFM:REP 62->126|PF02742|4e-15|55.4|65/68|Fe_dep_repr_C| HM:PFM:NREP 3 HM:PFM:REP 62->132|PF02742|1.1e-32|54.9|71/71|Fe_dep_repr_C| HM:PFM:REP 2->58|PF01325|5.6e-19|42.1|57/60|Fe_dep_repress| HM:PFM:REP 144->215|PF04023|6.1e-14|34.3|70/74|FeoA| GO:PFM:NREP 6 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01325|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF01325|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01325|IPR001367| GO:PFM GO:0003700|"GO:transcription factor activity"|PF02742|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF02742|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02742|IPR001367| RP:SCP:NREP 2 RP:SCP:REP 2->50|1on1A1|2e-10|40.8|49/56|a.4.5.24| RP:SCP:REP 62->130|1b1bA2|1e-22|39.1|69/76|a.76.1.1| HM:SCP:REP 1->61|1on2A1|4e-12|34.4|61/0|a.4.5.24|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 62->137|1g3sA2|5.1e-24|48.7|76/0|a.76.1.1|1/1|Iron-dependent repressor protein, dimerization domain| OP:NHOMO 441 OP:NHOMOORG 340 OP:PATTERN ---1-111111111121-------222113231121111111113123-1323-1-111111111-14 111-132233412322122-221122222222222222231111222122223233-2-111111211212---------1-1-----------1-1--111111131-211111-11111111--1-1-----1132234--111-------------------------------------31111---111111111111111111111111111111111111111111111111111111111111111-2-11-1---11111111----1111111111111111111111111111111112111111---1111----1111----1111-111----1-1----11---1-1----------11-1---------1------------------------1111111--1--------1----------2---------11111111-11----------------------------------------------------------------------------------------------------------------12-111------------------------2-------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------------------------------------------------------------------2----------------------------------------------211--------------------------1----1---11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHHHHHHHHHTccccHHHHHHHHcccHHHHHHHHHHHHHTTcEEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHTTTccHHHHHHHHHHcccccccTTcccccccGGGTcccEEHHHHcccccEEEEEEEccGGGccccTTHHHHHHTTTcEEEEcccccEccEEEEEEETTEEEEccHHHHHHcEEE DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHcccccEEEEEEEEEccHHHHHHHHHHHccccEEEEEEEEcccccEEEEEcccccEEEccHHHHHHHccc //