[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : trpS
DDBJ      :trpS         Tryptophanyl-tRNA synthetase
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  910/915 : Eukaryota  173/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:339 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->331 1yi8B PDBj 1e-97 55.8 %
:RPS:PDB   5->314 2akeA PDBj 1e-61 23.5 %
:RPS:SCOP  5->313 1o5tA  c.26.1.1 * 3e-68 24.9 %
:HMM:SCOP  5->316 1r6tA2 c.26.1.1 * 2e-85 39.2 %
:RPS:PFM   6->284 PF00579 * tRNA-synt_1b 3e-40 39.6 %
:HMM:PFM   5->288 PF00579 * tRNA-synt_1b 2.3e-71 35.2 273/292  
:BLT:SWISS 1->339 SYW_CLOLO e-139 73.1 %
:PROS 12->21|PS00178|AA_TRNA_LIGASE_I
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99033.1 GT:GENE trpS GT:PRODUCT Tryptophanyl-tRNA synthetase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 271973..272992 GB:FROM 271973 GB:TO 272992 GB:DIRECTION + GB:GENE trpS GB:PRODUCT Tryptophanyl-tRNA synthetase GB:NOTE COG0180 [J] Tryptophanyl-tRNA synthetase GB:PROTEIN_ID ABD99033.1 GB:DB_XREF GI:90820394 GB:GENE:GENE trpS LENGTH 339 SQ:AASEQ MAKEIILTGDRPTGKLHVGHYIGSLKKRVSMQNSGKYDSYIMIADQQALTDNARDPEKIKNSLIQVALDYLAVGLDPKKSTIFVQSQIPALAELNLYYLNLVTVSRLERNPTVKAEIQQKHFERSIPAGFFTYPVSQAADITAFKANLVPVGDDQEPMLEQTREIVRTFNSIYGEVLVEPQGVFAPKGSGRLPGLDGNAKMSKSLNNAIYLSDDADTLRKKVMSMYTDPNHIHVEDPGKVEGNMVFTYLDIFDKDKDKVAELKEQYRAGGLGDVKIKRYLNEVLEAELGPIRARREEFAKDIPAVYAMLKEGSEKANEVANKTLEEVRRAIGVNYFDNI GT:EXON 1|1-339:0| BL:SWS:NREP 1 BL:SWS:REP 1->339|SYW_CLOLO|e-139|73.1|338/341| PROS 12->21|PS00178|AA_TRNA_LIGASE_I|PDOC00161| SEG 90->101|alaelnlyylnl| BL:PDB:NREP 1 BL:PDB:REP 2->331|1yi8B|1e-97|55.8|326/331| RP:PDB:NREP 1 RP:PDB:REP 5->314|2akeA|1e-61|23.5|294/373| RP:PFM:NREP 1 RP:PFM:REP 6->284|PF00579|3e-40|39.6|265/279|tRNA-synt_1b| HM:PFM:NREP 1 HM:PFM:REP 5->288|PF00579|2.3e-71|35.2|273/292|tRNA-synt_1b| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF00579|IPR002305| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00579|IPR002305| GO:PFM GO:0005524|"GO:ATP binding"|PF00579|IPR002305| GO:PFM GO:0005737|"GO:cytoplasm"|PF00579|IPR002305| GO:PFM GO:0006412|"GO:translation"|PF00579|IPR002305| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00579|IPR002305| RP:SCP:NREP 1 RP:SCP:REP 5->313|1o5tA|3e-68|24.9|293/378|c.26.1.1| HM:SCP:REP 5->316|1r6tA2|2e-85|39.2|293/0|c.26.1.1|1/1|Nucleotidylyl transferase| OP:NHOMO 1325 OP:NHOMOORG 1119 OP:PATTERN --111--111111111--11-1--1--1--1-1-111211-11-----1----11-11-11---11-- 1111211111111111111-11111111111111111111112112111111111112112121212222112111111111111122111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112221111112122222122222222222111121211111111111111211111111111111111111211111111111111111111111111111111111111111111111111111211111111111111111112111111111111111111111111111132111111111111111211111111111111111111111111111111111-11112111112121111111111111111111111111111111111111111111111111111211111111111111111111111111111222122222221121222212222111111111111111111111111111221111111111111111121111111111111111112111111111111111111111111111111111112211111111111111111111111111111-1111111111121112211111111111-11111111111111111112221111221222222222222222111111111111111111111111111111111111211111111111111111111111111111111111112111121111111111111211211111222111111111111111111111111111111111111111111-11111111111111111111111111111111 ----121-----1211111-1-1-11-111111111-11111111111111-1111111111111111111111111--111111211-1111111---1111111112121-111312122214116-7G6-2141111211321121121221231123511111111512131111I222-11121131112-112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 334 STR:RPRED 98.5 SQ:SECSTR #cccEEEEEEcccccccHHHHHHHHHHHHHHHHHHTccEEEEEcHHHHHHHccccHHHHHHHHHHHHHHHHTTTccTTcEEEEEHHHHHHHTTccHHHHHHHHHHHTccHHHHHHHHcccccGTTccHHHHTHHHHHHGGGcGGGcHEEEEEGGGHHHHHHHHHHHHHTTccccEEEEEcEEEcccccEcccccTTcccccTTcGGGcccTTccHHHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHTcccccccHHHHHHHHHHHHHHHHHTccc#### DISOP:02AL 1-1,116-122,191-207,339-340| PSIPRED ccccEEEEccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHcccccHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHcEEEEEEHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccc //