[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54852.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:139 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->57 PF06114 * DUF955 1.9e-05 18.8 32/122  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54852.1 GT:GENE BAD54852.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(15225..15644) GB:FROM 15225 GB:TO 15644 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54852.1 LENGTH 139 SQ:AASEQ MRDAYPHIRISCREHLPPDLRAAWTTDGIYLDRALGQAARRCALTHEIVHLERGPVPRNPVLAASEERIVSDIAARRLIPLRSLLDAFMWTRPTNHHDLADELWVDVPTLLIRLRGLRRREIDELNRAIDRRWPWHIEN GT:EXON 1|1-139:0| SEG 110->125|llirlrglrrreidel| HM:PFM:NREP 1 HM:PFM:REP 26->57|PF06114|1.9e-05|18.8|32/122|DUF955| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccccEEEEcccccHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHcccccccccc //