[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54855.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:350 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   210->275 PF03374 * ANT 3e-04 36.2 %
:HMM:PFM   218->330 PF03374 * ANT 4.3e-21 25.5 106/112  
:HMM:PFM   95->125 PF10543 * ORF6N 8.5e-05 29.0 31/88  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54855.1 GT:GENE BAD54855.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 17098..18150 GB:FROM 17098 GB:TO 18150 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54855.1 LENGTH 350 SQ:AASEQ MPAAPLGCRRSAVNYATTPSGPAKNSWTPPQTHPETSGRRRGMAQPNLPVPSGADFTPVDLTTPDARLRRDALAARVDVLDKVGALRALPDDMHVTTEMVAEFYEVPTGTVRALVLDNRAELETDGYRVVTRSAFEVSYPKQLTSSASRIALFPRRAVLRVGMLLRDSAVARRVRDYLLDAEPVTPVMMPTGPELLAHAILEAQKMIAAKDAQIAQLDGKLAAAAPKLEYLDRHVAENDDVVTIEAWGHLYGLTEPKAFELLRGKDIIYRHLVGKRWSASKQRLVCEYEHLPYGDCIDWFSRRPQHDAPRHHNGQVRMTLYVKVFHSEDIARKAGLVGQMTLPEDQEGQP GT:EXON 1|1-350:0| SEG 65->81|darlrrdalaarvdvld| RP:PFM:NREP 1 RP:PFM:REP 210->275|PF03374|3e-04|36.2|58/112|ANT| HM:PFM:NREP 2 HM:PFM:REP 218->330|PF03374|4.3e-21|25.5|106/112|ANT| HM:PFM:REP 95->125|PF10543|8.5e-05|29.0|31/88|ORF6N| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF03374|IPR005039| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------1--------------------------------1---------------------------------------------------------------------------------------------------------------------------------------1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------- DISOP:02AL 1-7, 24-25, 28-46, 342-350| PSIPRED ccccccccHHHccccccccccccccccccccccccccHHHcccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccEEEEHHHEEEEccccccccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccEEEHHHHHHHccccHHHHHHHHHHccEEEEEEccccccccHHHHHHHHcccccHHHHHHHHccccccccccccccEEEEEEEEEEccHHHHHHHcccccccccccccccc //