Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54856.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:HMM:PFM   32->66 PF09483 * HpaP 0.0008 31.4 35/185  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54856.1 GT:GENE BAD54856.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 18147..18413 GB:FROM 18147 GB:TO 18413 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54856.1 LENGTH 88 SQ:AASEQ MISLTFWAEPAVITTDEATITVGAGEVDGGRHDGAERVAVVIHTRSADGNIIHGWAHLTAAQVAELIESLSGARAALALDTPTIGGVE GT:EXON 1|1-88:0| HM:PFM:NREP 1 HM:PFM:REP 32->66|PF09483|0.0008|31.4|35/185|HpaP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 87-88| PSIPRED cEEEEEEcccEEEEEcccEEEEEcccccccccccccEEEEEEEEccccccEEEHHHHHHHHHHHHHHHHccccEEEEEEccccccccc //