[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54858.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   36->78 PF08667 * BetR 0.00014 27.9 43/147  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54858.1 GT:GENE BAD54858.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 18787..19038 GB:FROM 18787 GB:TO 19038 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54858.1 LENGTH 83 SQ:AASEQ MVRTSNIPIGADFPTAAEVGAAVLADMVTCGVTVPELADALRLPIPAVQQRLTGAVDWLVPELITAARHLGVRASGWLEAGVR GT:EXON 1|1-83:0| HM:PFM:NREP 1 HM:PFM:REP 36->78|PF08667|0.00014|27.9|43/147|BetR| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcccc //