Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54859.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:BLT:SWISS 60->126 OPR2_ARATH 7e-04 37.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54859.1 GT:GENE BAD54859.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 19035..19460 GB:FROM 19035 GB:TO 19460 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54859.1 LENGTH 141 SQ:AASEQ MTAPYTSVDALKYLARYVRRTVNWTVDCLAMKDLFCDEHVELEAICQMADDLDALVGPLVEAWDRYSDGRPVESSVEIAPGQTFTHLWHPDPARNQPGTVTGRVLADPGVDHGTYEVRIIPPRTLSVVLHPPRPPLHVVRP GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 60->126|OPR2_ARATH|7e-04|37.7|61/100| SEG 127->140|vvlhpprpplhvvr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 137-138| PSIPRED ccccccHHHHHHHHHHHHHHHHcccHHEEHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEccccEEEEEEcccccccccccEEEEEEEcccccccEEEEEEEcccEEEEEEccccccEEEEcc //