Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54862.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:47 amino acids
:HMM:PFM   8->32 PF00293 * NUDIX 3.6e-05 40.0 25/135  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54862.1 GT:GENE BAD54862.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 20543..20686 GB:FROM 20543 GB:TO 20686 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54862.1 LENGTH 47 SQ:AASEQ MTRPTDTPLATYPLGRGERGETPAEAAQRAAIEAQHEPLFEIIEEDR GT:EXON 1|1-47:0| SEG 24->35|aeaaqraaieaq| HM:PFM:NREP 1 HM:PFM:REP 8->32|PF00293|3.6e-05|40.0|25/135|NUDIX| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 21-25, 46-47| PSIPRED ccccccccccccccccccccccHHHHHHHHHHcccccHHHHHHcccc //