[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54864.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->80 PF00926 * DHBP_synthase 0.00044 28.6 35/194  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54864.1 GT:GENE BAD54864.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 21750..22007 GB:FROM 21750 GB:TO 22007 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54864.1 LENGTH 85 SQ:AASEQ MNQPAITGLTNDEIVTLLQIATGYDGREIDEVLITLWSEAARRRRWTFTEAVNAVHEHFAEETTWIMPGHVTQLIRRERGRYWQE GT:EXON 1|1-85:0| HM:PFM:NREP 1 HM:PFM:REP 42->80|PF00926|0.00044|28.6|35/194|DHBP_synthase| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 80-85| PSIPRED cccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccc //