[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54869.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.1.1
:247 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  75->93 1gzrB  g.1.1.1 * 2e-04 26.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54869.1 GT:GENE BAD54869.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 24349..25092 GB:FROM 24349 GB:TO 25092 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54869.1 LENGTH 247 SQ:AASEQ MSAETDHLFLSRPEMSKLIDELRKLPRIVADLAVTIARLARVQVAGHSISLGAAAQSRPPIHLDAWQAEQALHWHLATTVRIVCEERGMPYVPVGWLAPDFIGPPRPGQQRMQPGHVPSTLELGRWLDRHVVSLAMTADAGALYLDLLAAVAECEAHIDLPPDDLVQIDQRRVDAANNKILTAYQIEKVAAKLGDVGRGLTRDRVRYLVKRGLREAGRDGETRFYRLGDVLAKHVQHGRRSKGGSAA GT:EXON 1|1-247:0| SEG 103->115|gpprpgqqrmqpg| SEG 138->152|adagalyldllaava| RP:SCP:NREP 1 RP:SCP:REP 75->93|1gzrB|2e-04|26.3|19/61|g.1.1.1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 108-114, 237-247| PSIPRED cccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHcccccccHHcccccccccccccHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccc //