[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54872.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->49 PF00355 * Rieske 0.00024 42.1 19/97  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54872.1 GT:GENE BAD54872.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 25645..25902 GB:FROM 25645 GB:TO 25902 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54872.1 LENGTH 85 SQ:AASEQ MNTPDWLHSMAAATIRDGYGVPSAPLGDGEFVSAAKACPHEGCDWELPIEWRKGATVTRLRGTIETDRLCQEHREAHVVENWSRS GT:EXON 1|1-85:0| HM:PFM:NREP 1 HM:PFM:REP 27->49|PF00355|0.00024|42.1|19/97|Rieske| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 84-85| PSIPRED cccHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccccccccccccccccEEEEccccccHHHHHHHHHHHHHHHccccc //