[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54876.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->65 PF04981 * NMD3 0.00024 21.6 51/236  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54876.1 GT:GENE BAD54876.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 26717..26929 GB:FROM 26717 GB:TO 26929 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54876.1 LENGTH 70 SQ:AASEQ MTAAVLAHVHCGDPIDTRYCHGCGGCRYTIPLTGLTQHGAHDLGVIEACPDCDTAAELVARWRQKHPEER GT:EXON 1|1-70:0| HM:PFM:NREP 1 HM:PFM:REP 9->65|PF04981|0.00024|21.6|51/236|NMD3| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 62-70| PSIPRED ccccEEEEEcccccccccEEccccccEEEEEcccccccccccccEEcccccccHHHHHHHHHHHcccccc //