[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54879.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   53->93 1bxiB PDBj 2e-06 20.0 %
:HMM:PFM   54->99 PF01844 * HNH 3.5e-13 40.0 45/52  
:BLT:SWISS 66->102 ZRAB3_MOUSE 2e-06 45.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54879.1 GT:GENE BAD54879.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 27468..27794 GB:FROM 27468 GB:TO 27794 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54879.1 LENGTH 108 SQ:AASEQ MPTRPPRVCPKCRQQAPSGQRCPCTPAWSGSAWGGGSTRRWRSMRASKLKADPICQAPGCRALAVEVDHVTPLARGGARYDWSNLQSLCHDCHTAKTAQDARAGRSRG GT:EXON 1|1-108:0| BL:SWS:NREP 1 BL:SWS:REP 66->102|ZRAB3_MOUSE|2e-06|45.9|37/1069| SEG 28->45|wsgsawgggstrrwrsmr| RP:PDB:NREP 1 RP:PDB:REP 53->93|1bxiB|2e-06|20.0|40/129| HM:PFM:NREP 1 HM:PFM:REP 54->99|PF01844|3.5e-13|40.0|45/52|HNH| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------1--------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 41 STR:RPRED 38.0 SQ:SECSTR ####################################################ccccGGGTTccccEEEEcccTTTTccccccGGEEEEcHHHH############### DISOP:02AL 1-4, 97-108| PSIPRED ccccccccccccHHHHHccccccHHHccHHHHHcccccHHHHHHHHHHHHcccccccccccccccEEccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccc //