[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54880.1
DDBJ      :             putative phage terminase small subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:162 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   49->146 PF05119 * Terminase_4 2e-13 40.0 %
:HMM:PFM   48->152 PF05119 * Terminase_4 1.3e-29 45.4 97/100  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54880.1 GT:GENE BAD54880.1 GT:PRODUCT putative phage terminase small subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 27896..28384 GB:FROM 27896 GB:TO 28384 GB:DIRECTION + GB:PRODUCT putative phage terminase small subunit GB:PROTEIN_ID BAD54880.1 LENGTH 162 SQ:AASEQ MGRTAAPAALRLIGGRSEGRDSGGRPVEQPPEFRRIPPKPPTWLSREAKAEWKRVVPGLSRLELLKEEDRASLAVYCETWATYVAALADVRKNGLTCENVTIYKDGTESRRTVKNPALVVAETAAAQLRGMAQEFGLTPAAEGKLAHLSAGRGSDDANNPFG GT:EXON 1|1-162:0| SEG 14->25|ggrsegrdsggr| SEG 30->41|ppefrrippkpp| RP:PFM:NREP 1 RP:PFM:REP 49->146|PF05119|2e-13|40.0|90/99|Terminase_4| HM:PFM:NREP 1 HM:PFM:REP 48->152|PF05119|1.3e-29|45.4|97/100|Terminase_4| OP:NHOMO 16 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -----------------1--------11-1------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----11----------------------------------------------------------1------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------12-----------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------ DISOP:02AL 1-4, 15-33, 143-159| PSIPRED cccccccHHHHHHccccccccccccHHccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccc //