[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54882.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->36 PF06912 * DUF1275 0.00029 26.5 34/209  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54882.1 GT:GENE BAD54882.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 30120..30401 GB:FROM 30120 GB:TO 30401 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54882.1 LENGTH 93 SQ:AASEQ MDLVIALAAFVCGALLVAGWTWWREPRYVAHRRVVVNLRTGTAVEGVITRTRGRILVVRDATVHSDGGSASPADGEIVLDRGNVDYIQALGRR GT:EXON 1|1-93:0| TM:NTM 1 TM:REGION 1->20| HM:PFM:NREP 1 HM:PFM:REP 3->36|PF06912|0.00029|26.5|34/209|DUF1275| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-26,31-32,34-34,39-40,45-46,48-48,53-54,59-60,62-62,93-94| PSIPRED cccHHHHHHHHHHHHHHHccHHHccccEEEEEEEEEEEccccEEEEEEEEcccEEEEEEEEEEEcccccccccccEEEEEccccHHHHHHccc //