[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54886.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->63 PF01568 * Molydop_binding 9.5e-06 19.0 42/109  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54886.1 GT:GENE BAD54886.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 33803..34045 GB:FROM 33803 GB:TO 34045 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54886.1 LENGTH 80 SQ:AASEQ MALISSRSAAPGRPPAKRRRNTMSLKRYEVEVNGHKTVLQLSDEDAKDRGLTAADEVKARPAANKAARAANKGQGATEGQ GT:EXON 1|1-80:0| SEG 5->20|ssrsaapgrppakrrr| SEG 58->72|karpaankaaraank| HM:PFM:NREP 1 HM:PFM:REP 21->63|PF01568|9.5e-06|19.0|42/109|Molydop_binding| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-22, 62-80| PSIPRED cccccccccccccccHHHHcccccEEEEEEEEcccEEEEEEcccccccccccccHHccccccccHHHHHccccccccccc //