[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54887.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:180 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54887.1 GT:GENE BAD54887.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 34046..34588 GB:FROM 34046 GB:TO 34588 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54887.1 LENGTH 180 SQ:AASEQ MTTPLPSLLSLEAYNTLVAGTGIEQMRLAAIVRDIRDYCGWHIAPAVEQTLVVDGSGATVQPLPTLRLNSITEVKENGHVLATDGFEWSHDGTLRRATPWTSRLRGIEATVNHGHDAVPENIVSVILDAASAALSLEVGEGAAAGPETMGPFSFGASEGGVTFTAAQRRVLDRYRIEKRA GT:EXON 1|1-180:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------1-----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 178-180| PSIPRED ccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccccEEEEccccccEEEEEEEEccEEEEccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEccEEEEEEcccccccHHHHHHHHHHHHHccc //