[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54888.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->78 PF05521 * Phage_H_T_join 0.00039 19.0 63/95  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54888.1 GT:GENE BAD54888.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 34597..34890 GB:FROM 34597 GB:TO 34890 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54888.1 LENGTH 97 SQ:AASEQ MIRHRGGGFDDNGDPIPYTDVDLRARAVAPGATAEYQDRGRNGQTVEMTVYFYPAVDLTGSDELTVRGERYLVQVEQWKSPRTRRTGTVALCSRGEG GT:EXON 1|1-97:0| HM:PFM:NREP 1 HM:PFM:REP 12->78|PF05521|0.00039|19.0|63/95|Phage_H_T_join| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cEEccccccccccccccccccccEEEEEcccccHHHHcccccccEEEEEEEEcccEEEccccEEEEccEEEEEEEEEccccccccccEEEEEEcccc //