[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54889.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->44 PF07171 * MlrC_C 0.00091 31.4 35/177  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54889.1 GT:GENE BAD54889.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 34890..35141 GB:FROM 34890 GB:TO 35141 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54889.1 LENGTH 83 SQ:AASEQ MVTSRVRLNNRTIANLLKSQGVADLVNRVAREVAAHAGEDADVDEYTTDRGAASVAVPAEQQAIEGALTRAAAAASLEVRQRP GT:EXON 1|1-83:0| SEG 71->75|aaaaa| HM:PFM:NREP 1 HM:PFM:REP 10->44|PF07171|0.00091|31.4|35/177|MlrC_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 6-7, 82-83| PSIPRED cccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHcccccccEEccccHHHHHHHHHHHHHHHHHHHccccc //