[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54891.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->100 3e3yA PDBj 9e-04 5.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54891.1 GT:GENE BAD54891.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 35579..36115 GB:FROM 35579 GB:TO 36115 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54891.1 LENGTH 178 SQ:AASEQ MALDPDNVKIWEYARVFVSFAVDRPALPASIDADYGTDWEEVGILSGDDGITEDRASSESKHFGWGIGLIKVGDKNFELTRKFWVLEDNATTQKIVNPGSTATKILMPKHTYAWLGFETDSDLGDKERLTTTRRAKLKVPANNRTESDPTKWEVNVLLFANGLGEVFDRQAGVPTPTP GT:EXON 1|1-178:0| RP:PDB:NREP 1 RP:PDB:REP 5->100|3e3yA|9e-04|5.5|91/242| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------1----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 51.1 SQ:SECSTR ####cHHHHHH###ccTTcccccccccccEEEEETTEEEEEEEEEEETT##ccccccEEEEHHHHHHHHHHHHHTTccccEEEEEEEEEEEEETTEEEEE############################################################################## DISOP:02AL 1-5, 176-178| PSIPRED ccccccccEEEccEEEEEEcccccccccccccccccccHHHcEEEEccccccccHHHHHHHHHccccEEEEccccccEEEEEEEEEccccEEEEEEcccccEEEEEEccEEEEEEEEEEEcccccEEEEEEEEEEEEEEccccccccccccEEEEEEEEccccccEEEcccccccccc //